KEGG   Pseudomonas antarctica: A7J50_4512Help
Entry
A7J50_4512        CDS       T04830                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
panr  Pseudomonas antarctica
Pathway
panr00260  Glycine, serine and threonine metabolism
panr01100  Metabolic pathways
panr01110  Biosynthesis of secondary metabolites
panr01120  Microbial metabolism in diverse environments
panr01130  Biosynthesis of antibiotics
panr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:panr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7J50_4512
Enzymes [BR:panr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A7J50_4512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 DUF4031 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ANF87864
UniProt: A0A172Z5U6
Position
complement(4966202..4967206)
Genome map
AA seq 334 aa AA seqDB search
MSVIDLRSDTVTQPTPGMLDAMASAVSGDDVYGEDPSVNHLEAELAKRLGFEAALFVPTG
TMSNLLALMAHCERGEEYIVGQQAHTYKYEGGGAAVLGSIQPQPLEVQADGSLDLDHVLA
AIKPDDFHFARTRLLALENTMQGKVLPLEYLAKARAFTHEHGLALHLDGARIYNAAVKLG
VPAREIAQHFDSVSVCLSKGLGAPVGSVLCGSTALIARARRLRKMVGGGMRQAGSLAAAG
LYALDHQVRRLADDHANAQWLGEALRKAGYAVEPVQTNMVYVQIGDQAQAFKAFAAERGI
KLSAAPRLRMVTHMDVSRAQIEQVVQTFVEFSRK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatcgacctgcgtagcgacaccgtgacccaacccacccccggcatgctcgac
gcgatggccagtgccgtcagtggcgacgatgtctacggcgaagaccccagcgtcaaccat
ttggaggccgagttggccaagcgcctgggcttcgaggcagcgttgtttgtgcccaccggc
accatgagcaacttgctggcgttgatggcccactgtgagcgcggcgaggaatacatcgtc
gggcaacaagcccatacctacaaatatgaaggcggcggcgcggccgtcctcggttcgatc
cagccgcagccgctggaggtgcaggcggacggctcccttgacctggaccacgtgctggcg
gcaatcaagcccgatgattttcacttcgcccgcacccgtctgctggccctggaaaacacc
atgcagggcaaagtgctgccgctggagtacctggcgaaggcgcgagcgttcacgcatgaa
catggccttgcgctgcatctggatggcgcgcgtatttataacgcggcggtcaagcttggg
gtgccggcgcgggagattgcccagcatttcgattccgtgtcggtgtgcttgtccaaaggc
cttggcgcgccggtgggttcggtgttgtgcggttccacggccttgatcgccagggcgcgt
cgcttgcgcaagatggtcggcggcggtatgcgtcaggccggttccctggcggcagcgggg
ctgtatgcgctggatcatcaggtgcggcgcctggccgacgaccacgccaatgcccaatgg
ctgggggaggcgttgcgcaaggccggttacgcggtggagccggttcagaccaacatggtg
tatgtgcagatcggcgaccaggcacaggcgtttaaggcgtttgctgctgagcgcgggatc
aagttgagcgccgcgccgcgcctgcgcatggtcactcatatggatgtcagccgggcgcag
atcgagcaggtcgtgcagacatttgtcgagttttcccggaaatga

DBGET integrated database retrieval system