KEGG   Pantoea sp. SO10: FCN45_09955Help
Entry
FCN45_09955       CDS       T06053                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
pans  Pantoea sp. SO10
Pathway
pans00620  Pyruvate metabolism
pans00630  Glyoxylate and dicarboxylate metabolism
pans01100  Metabolic pathways
pans01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pans00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FCN45_09955 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    FCN45_09955 (aldA)
Enzymes [BR:pans01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     FCN45_09955 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     FCN45_09955 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF1487
Motif
Other DBs
NCBI-ProteinID: QCP59681
Position
2131549..2132985
Genome map
AA seq 478 aa AA seqDB search
MTTHHQHYINGAFVADQNDKWIEVINPATEALLSRVPEGSKHDAAQAIDAAEVAQPNWEA
LPAVERGNWLRKIAAAIRQREQELTATIVAEGGKTQGLAQTEVLFTADYLEYMAEWARRY
DGEIVNSDRPNENIFVFRKAIGVTTGILPWNFPFFLIARKAAPALVTGNTIVIKPSELTP
NNAAIFAHIIHEIGLPKGVINFVYGYGPEIGQELAGNPKVGLVSLTGSVNAGIATMEAAA
KNVTKVSLELGGKAPAIVMDDADLDLAVKAIVSSRVINTGQVCNCAERVYVQEGIYDRFI
SALTTAMKQVKFGNPAEQNDIDMGPLITAAALERVEQKVTNAVADGGKVVLGGKRAGSKG
FYFEPTIITGVRQDMEIMQQEIFGPVLPVMTFKTLDEAIALANDCEYGLTSSIYTQNLNT
AMVALRKLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLEEFLQTHVAYLQFS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaccatcaacattatattaatggcgcgtttgtcgccgatcagaacgacaag
tggatagaagtgattaacccggcaactgaggcattactttcgcgcgtgccggaaggcagt
aaacacgacgccgcgcaggccatcgacgctgctgaagtggcgcagccgaattgggaagcg
ctccccgccgttgaacgcggcaactggctgcgcaaaattgccgctgctattcgtcagcgt
gaacaagaactgaccgccactatcgtcgccgaaggcggaaaaacccagggtctggcgcaa
actgaagtactgtttacagctgattatcttgagtacatggccgaatgggcacgccgttat
gatggcgagatcgttaatagcgatcgtcccaacgaaaacatctttgtgttcaggaaagcg
attggcgtcaccaccggcattctgccgtggaacttccccttcttcctgattgcacgtaaa
gccgcgcccgcgctggtaaccggcaatactattgttatcaagccaagtgagcttacgcct
aacaatgcggcgatttttgcgcacatcatccatgaaattggtctgccgaaaggcgtgatc
aactttgtttacggctatgggccggagattggtcaggagctggcaggcaacccgaaagtc
ggcctggtcagtctgaccggcagcgtcaacgccggtatcgccaccatggaagctgcagcg
aaaaatgtcaccaaagtatcactggagctgggcggaaaagcgccggccatcgtcatggat
gatgccgatctcgatctcgcggtcaaagcgattgttagctcccgcgtgatcaacaccgga
caggtgtgtaactgtgctgaacgcgtttacgtgcaggaaggcatttacgaccgctttatc
agcgccctaaccaccgccatgaagcaggtgaagttcggtaatcctgccgagcaaaacgat
attgatatgggtccgctgattactgcggccgcgctggaacgcgttgagcagaaagtgacg
aacgcggtcgcggatggcggcaaagtagtgctaggcgggaagcgtgcaggcagcaaaggc
ttctattttgagccaaccattatcacgggcgtgcgtcaggatatggagatcatgcagcag
gagatttttggtccggtgctgccagtaatgacctttaaaacccttgatgaagccatagcg
ctggcgaatgactgtgaatatggtctgacctcatcgatttacactcagaacctcaacacc
gcgatggttgccctgcgtaagttgaagtttggtgaaacctatatcaaccgcgaaaacttc
gaagcgatgcaaggcttccatgcgggctggcgtaaatcgggcattggcggcgctgatggc
cgtcacggtttggaagagttcttgcagacgcacgtggcgtatttgcagttctcgtag

DBGET integrated database retrieval system