KEGG   Pantoea sp. PSNIH1: PSNIH1_01460Help
Entry
PSNIH1_01460      CDS       T03464                                 

Definition
(GenBank) histidine kinase
  KO
K07711  two-component system, NtrC family, sensor histidine kinase GlrK [EC:2.7.13.3]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant02020  Two-component system
pant02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pant00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSNIH1_01460
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSNIH1_01460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pant01001]
    PSNIH1_01460
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pant02022]
    PSNIH1_01460
Enzymes [BR:pant01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PSNIH1_01460
Protein kinases [BR:pant01001]
 Histidine kinases
  NtrC family
   PSNIH1_01460
Two-component system [BR:pant02022]
 NtrC family
  GlrK-GlrR (amino sugar metabolism)
   PSNIH1_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 Ni_hydr_CYTB FlgN
Motif
Other DBs
NCBI-ProteinID: AIX49015
Position
complement(270848..272278)
Genome map
AA seq 476 aa AA seqDB search
MRWRPFPRSLRQLVLMAFLLVLLPLLVLAWQAWESLSALSNQAADTNRNTFTDVRRSEAM
ARTALELERSYRQYCVLGDAALVRLYTTQWTRYGQMLNSHAASLPELPTFTLLRSTLPQL
ATAACENGNPSASGAAALERFSDANARMVQATRDVVFSRGLQLQRDIAERGQFFGWQALI
LFLVTLMLVLLFTGMIIGPVKRVERMINRLGEGQSLENNVSFRGPRELRSLGQRIAWLSE
RLSWLEAQRHEFLRHLSHELKTPLASLREGTELLADGVAGPLNAEQQEIVAILDSSSRHL
QRLIEQLLDYNRKLNEMPLTPEPVALDAIVAAVTRVHSLPASARRIKTHVDLQATRCLAE
ATLLERVIDNLYSNAVNYGRESGNIWLHSRQKGDRVWIDVANSGTAIPPEEQAMIFEPFY
QGSQQRQGPVKGSGLGLSIAKDCLRRMQGDLQLVSHKEADVCFRIILPAGARKPEP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagatggcgtccgtttccccgatccctgcgacaactggttctgatggcctttttactg
gtgctgctgccgctgctggtgctggcgtggcaggcgtgggaaagcctctctgcgctcagt
aatcaggcggcagataccaaccgcaatacctttaccgacgtgcggcgcagcgaggcgatg
gcccgcaccgccctggagcttgagcgcagctatcgtcaatattgcgtactcggtgatgct
gcgctggtcagactctataccacccagtggacccgctacgggcagatgctgaacagccat
gcggccagcctgccggaactgcccacgtttaccctgctgcgcagcacgctgccgcagctc
gccacggccgcctgcgaaaacggtaatccttcagcgtccggtgccgctgcgctggagcgc
ttttctgatgctaacgcgcgtatggtgcaggcgacgcgcgacgtggtgttttcccgcggg
ctgcagctgcagcgcgatatcgccgagcgcggtcagttctttggctggcaggcgctgatc
ctgttcctggttacgctgatgctggtgctgctgtttaccggcatgattatcgggccggta
aagcgcgtggagcggatgatcaaccggctgggggaagggcagtcgctggaaaataacgtc
agctttcgcggaccgcgtgagctgcgctcgctgggacagcgtattgcctggcttagcgaa
cggctaagctggctggaggcacagcgacatgaatttttacgtcatctttcacacgagctg
aaaacgccgctcgccagcctgcgcgaaggcacagagctgctggccgatggcgttgccgga
ccgcttaatgcagagcagcaggagatcgtcgctattctcgacagcagcagtcgccatctg
cagcgcctgattgagcagctgctggattacaaccgcaagctgaacgagatgccgcttact
ccggagccggtcgcgctggatgcaatcgtggcggctgtcacccgcgtgcattcactgcct
gccagcgcccggcgaataaaaacgcacgttgatctgcaggccacccgctgtctggcggaa
gcgacgctgctggagcgcgttatcgataacctctactcgaacgccgtgaactatggtcgt
gaatccggtaacatctggctgcacagccggcaaaaaggcgaccgggtgtggattgatgtg
gcgaatagcggtactgcgattccgccagaggagcaggcgatgatcttcgaacctttctac
cagggcagccagcagcggcaggggcccgtaaaaggcagcggcctgggcctgagcattgca
aaagattgtctgcggcgcatgcagggagacctgcagctggtcagtcacaaagaggcagat
gtctgtttccgcattattttacccgccggtgccaggaagcctgaaccatga

DBGET integrated database retrieval system