KEGG   Pantoea sp. PSNIH1: PSNIH1_06105Help
Entry
PSNIH1_06105      CDS       T03464                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00051  Fructose and mannose metabolism
pant01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PSNIH1_06105
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PSNIH1_06105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: AIX49845
Position
complement(1248735..1249883)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIELVFADVNQVVLDALNARHTYPVHVVGEQAKTETV
TGVSAVNSTSDDIIALIAEVDLVTTAVGPQILERIAGSVAQGLIARHDRGNTAPLNIIAC
ENMVRGTSQLKQHVLKALPAQHHAWAEAHVGFVDSAVDRIVPPSEAGSSDPLEVTVETFS
EWIVDKTQFKGALPAIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHVTIRDAIL
DSRIRAVVEGAMQESGAVLIRRYDFDAEKHAAYISKILTRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHDNLVQGIAAAMHYRSDADPQAQELATLIAEQGVAETLVK
ISGLEPESQAVEAVVSAYSAMA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttacattttggagcaggcaatattggtcgcggatttatcggcaagctgctg
gccgatgccggcatcgagctggtctttgctgacgtcaatcaggttgtgctggatgccctt
aacgcccgtcacacttatccggttcatgttgttggcgaacaggcaaaaacggagacggtc
accggcgtcagcgccgttaacagcaccagcgatgacatcattgcgctgatcgctgaagtc
gatctggtcacgactgccgtcggaccgcagatcctcgaacgtattgccggcagcgtggcg
cagggtctgatcgcccgtcacgatcggggtaatacggcaccgcttaacatcatcgcctgc
gaaaatatggtgcgcggcaccagtcagctgaagcagcatgtgctgaaggcgctgccggcg
cagcatcacgcctgggcagaagcgcacgtcggctttgtcgattccgccgtggatcgtatt
gtcccgccttctgaagcgggcagcagcgatccgctggaagtgaccgttgagaccttcagc
gaatggattgttgataaaacgcagtttaaaggggcgctgccggcgatccctggcatggaa
ctgaccgacaatctgatggcgtttgttgaacgcaagctctttacccttaataccggccac
gctattaccgcttatctgggcaaactggcgggtcatgtaaccattcgcgatgcgatcctg
gatagccgcattcgcgccgtggttgagggggccatgcaggagagcggcgccgttctgatc
aggcgctacgattttgatgcagagaaacatgcggcttacatcagcaaaatccttacccgc
tttgagaacccttacctgaaagatgacgtcgagcgcgtaggccgccagccgctgcgcaag
ctgagcgcaggcgatcgcctgattaaaccgctgctcggcacgctggagtaccagctgccg
cacgataatctggtgcaggggatcgcagccgcgatgcactaccgcagcgatgccgatccg
caggcgcaggagctggccacgctgatcgcggaacagggcgttgcagagacgctggtaaaa
atttccggcctggagccggagagtcaggcagtagaggctgtggtgagcgcttacagcgct
atggcataa

DBGET integrated database retrieval system