KEGG   Pantoea sp. PSNIH1: PSNIH1_11460Help
Entry
PSNIH1_11460      CDS       T03464                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00010  Glycolysis / Gluconeogenesis
pant01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSNIH1_11460
Enzymes [BR:pant01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     PSNIH1_11460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AIX50810
Position
2409456..2411114
Genome map
AA seq 552 aa AA seqDB search
MNYGMGTMIKKLSLCALSVVAALPVSLSATAAEGDMQLQQVLMLSRHNLRAPLATNGSAL
EQSTKKSWPQWDVPGGELTTKGGVLEVYMGKYTRQWLTQQGLLAGGNCPDTSDVFIYANS
LQRTVATAQFFAAGAFPGCDVAVTHQDAMGTMDPIFNPVITDDSEAFNKKALAAMTAENE
KLALKPALQRLEKIVDYKSSPACNGKKQCTLDSGDNTFSADNGKEPGVSGPLKIGNSLVD
AFTLQYYEGFPAEQVAWGQIKTPEQWKELASVKNGYQDALFSSPEVAREVAAPLVDYIRS
QLVDEDKASAPKVTLMVGHDSNIASLLSALQVKPYTLPGNDEKTPIGGQVVFERWHDGKN
NKDLLKIEYVYQTADQLRNADVLSLKNPPKRVTLQLAGCDTDANGYCSWEQFSAALNSAL
QGTPMQPAAVQEAKPQQAADSAPDAKAAAEKPADDNAKAKDKAEQAAADKAKADAAADKA
KADAAAEKTAADKAKADKAAADKAAADKAKADKAAEDKAKADAAAAQNAQPEAASGKPAA
EAKPAQQPATAG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaattatggaatgggcacaatgatcaaaaaactgagtctttgcgcgttgtcagttgtt
gcggcgcttccggtaagcctgtcagcgaccgcagcagaaggggatatgcagctgcagcag
gtgctgatgctgagccgtcacaatctgcgtgcgccgctggcgacaaacggcagcgcactg
gagcaatccactaaaaagagctggccgcaatgggatgtgccgggcggtgaactcaccacc
aaaggtggcgtgctggaagtctatatgggtaaatatacccgtcagtggctgacgcagcag
gggctgctggctggcggcaattgcccggataccagcgatgttttcatttatgcaaatagc
cttcagcgcaccgttgcgaccgcacagttttttgctgcgggtgcctttcctggctgtgac
gttgcggtaacgcatcaggatgccatgggaacgatggatcccatctttaatccggtgatt
accgatgacagcgaagcgtttaacaaaaaagcgctggcggcgatgacggcagagaatgag
aagctggcactgaagcctgcgctgcagcgtctggaaaagattgttgattataaatcgtcg
cctgcctgcaatggtaaaaagcagtgcacgctggacagcggtgataacactttcagcgca
gataatggcaaagagccaggcgtcagcggtccgctgaaaatcggtaattcccttgttgat
gcgttcacgctgcaatattacgaaggtttcccggcagagcaggttgcctgggggcagatt
aaaacgcctgagcagtggaaagagctggcgtcagtcaaaaacggttatcaggatgcgctc
ttcagctcgccagaggttgcgcgtgaagttgctgcaccgctggtggattacatccgcagc
cagctggttgatgaagataaggccagcgcacctaaagtaacgctgatggtagggcatgat
tcaaatatcgcctcgctgctcagcgcgctgcaggtgaagccttacactctgccgggcaac
gatgagaaaacccctatcggcggacaggttgtatttgaacgctggcacgatggcaaaaat
aacaaagatctgctgaaaatagagtatgtctatcagaccgccgatcagctgcgtaacgca
gatgtgctgagcctcaaaaacccgccaaaacgtgtcacgctgcagcttgccggctgtgat
actgatgccaatggctattgcagctgggagcagttctctgcggcactgaacagcgcactg
caggggacgcctatgcagcctgcggccgtgcaggaagcgaagccgcagcaggctgcagat
agtgcgccggacgcgaaagctgccgcagagaaaccggctgacgataacgctaaagctaaa
gataaagctgaacaggcggctgctgataaagcgaaagcagacgccgccgcagataaggcg
aaagcagacgctgccgcagagaaaaccgctgctgataaggcgaaagcggacaaagcagcc
gctgataaagcggcggctgataaagcgaaagcggacaaagcagcagaagataaagcgaaa
gctgatgctgctgcagcgcaaaacgcgcagccggaggcggcatccggtaaacccgccgct
gaggcaaagccagctcagcaacctgctaccgcaggttaa

DBGET integrated database retrieval system