KEGG   Pantoea sp. PSNIH1: PSNIH1_15110Help
Entry
PSNIH1_15110      CDS       T03464                                 

Gene name
putA
Definition
(GenBank) transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00250  Alanine, aspartate and glutamate metabolism
pant00330  Arginine and proline metabolism
pant01100  Metabolic pathways
pant01110  Biosynthesis of secondary metabolites
pant01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSNIH1_15110 (putA)
   00330 Arginine and proline metabolism
    PSNIH1_15110 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pant03000]
    PSNIH1_15110 (putA)
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PSNIH1_15110 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PSNIH1_15110 (putA)
Transcription factors [BR:pant03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PSNIH1_15110 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1
Motif
Other DBs
NCBI-ProteinID: AIX51460
Position
3169226..3173170
Genome map
AA seq 1314 aa AA seqDB search
MGTTTMGVKLDEATRERIKLAAQKVDRTSHWLIKQAIFNYLTQLEAGETLPEIPLQASET
TAEESLPEESLQPFLDFAEHILPQSVTRSAITAAWRRPETEAVPMLLEQARLPAPLAEKT
HQLAYSLADKLRHQKGATGRAGMVQSLLQEFSLSSQEGVALMCLAEALLRIPDKPTRDAL
IRDKISNGNWQSHLGRSSSMFVNAATWGLLFTGRLVSTHNEASMSRSLNRIIGKSGEPLV
RKGVDMAMRLMGEQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAKAYLLSY
QQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPILKSLTLLARSYD
IGINIDAEEADRLELSLDLLEKLCFEPELEGWNGIGFVIQAYQKRCPMLIDSLVDLAQRS
RRRLMIRLVKGAYWDSEIKRAQMEGLEGYPVYTRKVYTDISYLACARKLLAVPSQIYPQF
ATHNAHTLAAIYNLAGNNYYPGQYEFQCLHGMGEPLYEQVVGKVADGKLSRPCRIYAPVG
THETLLAYLVRRLLENGANTSFVNRIADKSLPIDELVADPVVAVEKMGAAEGAVGLPHPK
IPLPRDLYGDKRPNSAGLDLANEHRLASLSSALLNSASQPWVAQPMIEGTLETGVSQPVL
NPAAPADVVGSVREATETEVSAALDAAVSAGPIWFATPPAERAAILERAGQAMEAQMQQL
IGLLVREAGKTYNNAIAEVREAVDFLYYYAGMVRDDFDNETHRPLGPVVCISPWNFPLAI
FTGQIAAALAAGNSVLAKPAEQTPLIAAQAVQILLDAGVPAGVLQLLPGQGETVGAQLTG
DERVRGVMFTGSTAVATLLQRNLAGRLDPQGRPTPLIAETGGMNAMIVDSSALTEQVVVD
IVASAFDSAGQRCSALRLLCIQEDAADHTIKMLRGAMAECRMGNPERLSTDIGPVIDQEA
KAGIERHIQAMRNKGFTVYQAVQENAQDRKEWESGTFIKPTLIELDQVSDLDKEIFGPVL
HVVRFSRSSLPQLIEQINATGYGLTLGVHTRIDETIAQVTANAHVGNLYVNRNMVGAVVG
VQPFGGEGLSGTGPKAGGPLYLYRLLAHRPDGALRLTFDRQDAEQPVDSSVRTTLMGAHQ
ALQNWAQDKPALQALCQRYDELSQAGTVRLLPGPTGERNTFSLLPRERVLCLADNEQDAL
IQLAAVTSVGSQALWQDDELHRALLKALPPAVQQRIRLAKDALSGEFDAVIYHGDADQLR
TLCADIAAREGAIVSVQGFARGETNLLLERLLIERSLSVNTAAAGGNASLMTIG
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaactaccatgggggtgaagctggatgaagccacccgcgagcgcattaagctg
gcagcacagaaggtcgatcgcacatctcactggctgattaagcaggctattttcaattac
ttaacccagcttgaagcgggcgaaaccctgccggaaattcccctgcaggccagcgaaacc
acggcggaagagagcctgcccgaagagagtctgcagccgttcctcgactttgctgaacac
attctgccgcagtcggttacccgctccgcgatcaccgctgcatggcgccggcccgagacg
gaagcggtgccgatgctattggagcaggcacgcctgcccgctccgctggcagagaaaacc
catcagctggcttatagccttgccgacaaactgcgtcaccagaaaggtgcaaccggacgc
gccggaatggtgcaaagcctgctacaggagttctccctctcctcgcaggagggcgtggcg
ctgatgtgcctggcagaagcgctgctgcgtattccggataaacctacccgtgacgcgctg
atccgcgacaaaatcagcaacggcaactggcagtcgcacctgggccgcagctcatccatg
tttgtgaacgccgcgacctggggcctgctgtttaccggacgcctggtctcaacccataac
gaagcgagcatgtcccgctcgctgaaccgtattatcggtaaaagcggcgagccgctggtg
cgcaaaggcgtggatatggcgatgcgcctgatgggcgagcagttcgttaccggcgagacc
atcgctgaggcgctggccaacgcccgcaagctggaagagaaaggcttccgctactcctac
gatatgctcggtgaagcggccctgaccgccgccgatgcgaaagcctatctgctctcttat
cagcaggcgatccatgcgattggtaaagcctccaacggccgcggcatctatgaaggcccg
gggatctcgatcaaactctctgcactgcatccacgctacagtcgcgcccagtacgatcgc
gttatggaagagctctatccgatcctgaaatcgctgacgctgctggcgcgttcctatgac
atcggcatcaatatcgatgccgaagaagccgatcgccttgagctgtcgctggatctgctg
gaaaaactctgctttgagcctgaactggaaggctggaacgggattggcttcgtgattcag
gcttaccagaaacgctgcccgatgctgatcgactcgctggtcgatctggcacagcgcagc
cgtcgccgcctgatgatccgtctggtgaaaggcgcctactgggacagcgaaatcaagcgc
gcgcagatggaaggccttgaaggctatccggtttatacccgcaaggtatataccgatatc
tcttatctcgcctgcgcccgcaaactgctggcggtaccgagccagatctacccgcagttt
gccacgcacaacgcccacacgctggccgctatctataatctggcgggtaataactactat
ccgggtcagtatgagttccagtgcctgcacggcatgggcgagccgctctatgaacaggtg
gtaggcaaagtggccgatggcaaactcagccgcccctgccgtatctacgcgccggtgggc
acgcatgaaacgctgctggcttacctggtacgtcgtctgctggaaaacggtgccaacacc
tcctttgtcaaccggattgccgataagagcctgccgatagatgagctggttgccgacccg
gtggtagcggtggaaaaaatgggtgcagccgaaggcgccgtgggtctgccacatccgaag
atcccgctgccgcgcgatctctatggcgacaagcgtccgaactcagcgggtctcgacctc
gcaaatgaacatcgcctcgcctcactctccagcgccctgctgaacagcgcgagccagcca
tgggtggcccagccgatgatcgagggcaccctggaaacgggtgtcagccagccagtactg
aacccggcggcgccggctgacgtggtcggcagcgtgcgtgaagccaccgaaaccgaagtc
tctgccgcgctggatgccgcggtcagcgccggaccgatctggtttgcgaccccgccagcc
gagcgcgcggcgatccttgagcgtgccggtcaggcgatggaagcgcagatgcagcagctg
attggtctgctggtgcgcgaagcgggcaaaacgtacaacaatgccatcgccgaagtgcgc
gaagcggtcgatttcctctactactacgccggtatggtacgcgatgatttcgacaacgaa
acgcatcgtccgctgggtccggtagtctgtatcagcccgtggaacttcccgctggcgatc
tttaccggccagattgccgccgcgcttgctgccggtaacagcgtgctggcaaaaccggct
gagcagacgccacttatcgcggcgcaggcggtgcagatcctgctggatgcaggcgttccc
gccggcgtgctgcagctgctgcccggccagggtgaaaccgtgggcgcacagctcaccggc
gatgagcgcgtgcgcggcgtcatgttcaccggctcaaccgccgtggcgacgctgctgcag
cgtaatcttgccggccgtctcgatccgcaggggcgtccgacgccgctgatcgcagaaacc
ggcggcatgaacgccatgatcgttgactcctctgccctcaccgaacaggtggtggtggat
atcgttgcctcagcgtttgacagcgccggccagcgctgttcggcactgcgtctgctctgt
attcaggaagatgccgccgatcacaccattaaaatgctgcgcggcgcgatggcggagtgc
cgcatgggcaatccggaacgcctttcaactgatatcggtccggttatcgaccaggaagcg
aaagcgggcattgagcgtcacattcaggcaatgcgcaacaaaggctttaccgtttatcag
gcggtgcaggagaatgcgcaggaccgtaaagagtgggagagcggcacctttatcaaacct
acgctgattgagctggatcaggtcagcgatctcgataaagagatcttcggaccggtgctg
cacgtggtgcgcttctcacgcagcagcctgccgcagctgattgagcagatcaacgccacc
ggctatggcctgacgcttggcgtccatacgcgtattgatgaaaccatcgctcaggttact
gcgaatgcgcacgttggcaacctgtatgtaaaccgtaatatggtcggtgccgtagtaggc
gtgcagccgtttggcggcgaaggcctctccggtaccggcccgaaagcgggtggcccgctc
tatctctatcgcctgctggcacatcgtccggatggcgcgctgcgcctgaccttcgatcgt
caggatgctgagcagccggtcgacagcagcgtgcgtacaacgctgatgggcgcgcaccag
gcgctgcagaactgggcgcaggataagccagcattgcaggcgctgtgtcagcgttacgat
gagctgtcgcaggcgggcacggtgcgtctgctgccgggcccgacgggcgagcgcaacacc
ttcagcctgctgccgcgcgaacgcgtgctctgcctggccgataatgagcaggatgcactg
atccagctggccgcggtaaccagcgtcggcagtcaggcgctatggcaggatgatgagctg
catcgtgccctgctgaaagcgctgccgccggcagtacagcagcgcatccggctggccaaa
gatgccctgtccggtgagtttgatgcggtgatctatcacggtgatgccgatcagctgcgt
acgctgtgtgccgatattgctgcacgcgagggcgccattgtttccgtccagggctttgcc
cgcggagaaaccaatctgctgctggagcggttgctgattgaacgctcgctgagcgtcaac
accgcagcagcaggcggcaacgccagtctgatgaccatcggttaa

DBGET integrated database retrieval system