KEGG   Pantoea sp. PSNIH1: PSNIH1_p00315Help
Entry
PSNIH1_p00315     CDS       T03464                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00625  Chloroalkane and chloroalkene degradation
pant00680  Methane metabolism
pant01100  Metabolic pathways
pant01120  Microbial metabolism in diverse environments
pant01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PSNIH1_p00315
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSNIH1_p00315
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PSNIH1_p00315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc AlaDh_PNT_C Glu_dehyd_C HI0933_like FAD_binding_3 FAD_oxidored TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJA70948
Position
pPSP-057:63237..64370
Genome map
AA seq 377 aa AA seqDB search
MKAVIYNGPYDVKVKDVPDAKIVRPTDVLVRITTTNICGSDLHMYEGRTSFEQGRILGHE
NLGEVVEIGSGVERVKVGDYVCLPFNVGCGFCENCEKGLTGFCLTTNPGNVGAAYGFAEM
GSWEGGQAELLRVPFADFNCLVLPPDAVEKEDDYVMLSDIFPTGWHATELAGLKPGESVA
IYGAGPVGLMAAHSAMIKGASQVFVVDTHQDRLALAEKMGATGINATGDEAVQRILDLTD
GRGTDCGCECVGYQCCNKHGHEDNSVTMNSLVASTKATGGIGVVGVFIPQDPGAASDLAK
EGKMPFDFGSFWFKGQSIRTGQANVKAYNRQLARLIHQGKASPGGIISHRLSLAEAPEGY
KHFDDRDEGWTKVILKP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttatttacaacggtccctatgatgtaaaagttaaagacgtgccggatgca
aaaattgttcgccccaccgatgtgcttgtccgcattaccaccaccaatatttgtggatcg
gatttgcacatgtacgagggtcggaccagctttgagcagggacgtattttggggcacgaa
aacctgggtgaggtggttgaaattggctcaggagtggagcgtgttaaggtcggtgactat
gtctgtctgccatttaatgtcggatgcggtttttgcgagaattgtgaaaaaggtctgacc
ggtttttgcctcaccaccaatcccggtaatgtgggcgcggcctatggttttgctgaaatg
ggctcctgggagggtggtcaggcggaactgcttcgggtcccctttgcagactttaactgc
ctggtgcttccgcctgacgcagtagaaaaagaagatgattatgtgatgctctctgacatt
ttccctaccggctggcatgcgacagaactcgccggattaaagcctggcgaaagcgtagcc
atttacggcgcggggccggtgggtctgatggccgcacactcagccatgataaaaggcgct
tcacaggtatttgtagtggatacacaccaggaccgtttagcgctggcagagaaaatgggg
gcgacgggcatcaatgcgaccggcgatgaagccgtgcaacgaattctcgacttaactgac
ggacgcggcactgactgtggctgtgaatgcgtgggctatcagtgctgtaacaaacatggc
catgaagataattcggtcactatgaacagcctcgttgcatcaaccaaagcaaccggggga
attggtgtggttggcgtgtttatcccgcaggatccaggagctgcatcagaccttgccaaa
gaaggtaagatgccgtttgatttcggcagtttttggtttaaaggacagtcaatccgcacc
ggccaggcgaacgtcaaagcctataatcgtcagctggcccgtctgatccatcagggtaaa
gccagcccgggcggcataatctcacaccgtctttcacttgctgaggcgcctgagggatat
aagcactttgacgatcgcgatgagggatggacgaaggttatccttaagccttaa

DBGET integrated database retrieval system