KEGG   Pantoea sp. PSNIH1: PSNIH1_p00395Help
Entry
PSNIH1_p00395     CDS       T03464                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00030  Pentose phosphate pathway
pant01100  Metabolic pathways
pant01120  Microbial metabolism in diverse environments
pant01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSNIH1_p00395
Enzymes [BR:pant01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     PSNIH1_p00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase PALP GDP_Man_Dehyd Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AJA70963
Position
pPSP-057:77093..77893
Genome map
AA seq 266 aa AA seqDB search
MQISLEKQVALVTGASSGLGYACAEALAAAGAAVVINYNSQQEPAEALADAIRQRGGKAV
AVGGDVSDEKAVDALFAETIKHFGRLDILVANSGLQRDAPAGEMTLDEWNKVIQVNLTGQ
FLCARAALRQFRQQEKRPDVSRATGKIIHMSSVHQLIPWAGHINYAASKGGVDLLMRSLA
QEVGEEHIRINAIAPGAIRTPINTEATEGEAEKKLLQLIPYGRVGDPEDVGNAVVWLASD
LSDYVHGTTLFIDGGMSLYPGFRDNG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcagatatcactggagaaacaggttgcactggtcactggcgccagttcaggactgggc
tatgcctgcgctgaagcgctggcggcggcgggtgcagcggtcgtgatcaactataacagc
cagcaggagcctgccgaggcgctggcagacgcgattcggcagcgtggcggtaaagcagtg
gcagtagggggtgacgtttctgatgaaaaagcggtggatgcgctgtttgctgaaacaatt
aaacattttggacggctggatattctggtcgcgaactccggactgcagcgcgatgcacca
gccggagaaatgacgctggatgagtggaataaggttatccaggtcaatcttaccggtcag
tttctctgcgcccgggcggcgctgcgtcagtttcgccagcaggagaaacgtccggatgtg
agccgcgctaccggcaaaatcatccatatgagctcggtgcatcagctcatcccgtgggcc
gggcatattaactatgcggcctccaaaggcggtgtcgatctgctgatgcgcagtctggcg
caggaagtgggcgaagaacatattcgtatcaatgccattgcgccgggtgcgatcagaacg
ccaatcaataccgaagcgaccgaaggtgaagctgagaaaaagctgctgcagcttatcccc
tatggccgggtaggcgatccggaagatgtgggtaacgcggtggtatggctggccagcgat
ttgtccgactacgtgcatggcaccacgctgtttattgatggtggcatgagcctgtatccc
ggctttcgtgataacggttaa

DBGET integrated database retrieval system