KEGG   Pantoea sp. At-9b: Pat9b_0227Help
Entry
Pat9b_0227        CDS       T01386                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00270  Cysteine and methionine metabolism
pao00920  Sulfur metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01130  Biosynthesis of antibiotics
pao01230  Biosynthesis of amino acids
Module
pao_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pat9b_0227
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pat9b_0227
Enzymes [BR:pao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Pat9b_0227
    2.3.1.46  homoserine O-succinyltransferase
     Pat9b_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ADU67553
UniProt: E6WI39
Position
274403..275332
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVNFLRNENVFVMTSSRASVQEIRPLKVLVLNLMPKKIETENQFLRLLSN
SPLQIDIQLLRIDSRESRNTPTEHLNNFYCNFEDIQDDNFDGLIVTGAPLGLVDFNDVAY
WPQIQRVLHWAKEHVTSTLFVCWAVQAALNILYGIPKQTRQHKLSGVYEHQILHPHALLT
RGFDDNFLAPHSRYADFPSQLIRDYTDLELFAESESTGAYLMASKDKRLAFVTGHPEYDA
LTLSGEYHRDYDAGLNPEVPFNYFPHDNPELPPRATWRSHGNLLFSNWLNYYVYQITPFD
LRHMNPTLE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcagggtccccgacgagttaccggcagtgaatttcttgcgcaacgagaatgtc
tttgtgatgacctcgtcgcgcgccagtgttcaggagatccgtccgctgaaagtgctggtc
ctcaatctgatgccaaaaaaaattgagaccgaaaaccagttcctgcgtctgctctccaac
tcgccattgcagattgatattcagctgctgcggatcgacagccgtgagtcacgtaataca
ccgaccgagcacctgaataatttctactgtaattttgaagatattcaggatgataacttc
gatggcctgattgtcaccggcgcgccgcttggtctggtggatttcaatgatgtggcgtac
tggccgcagattcagcgtgtgctgcactgggcaaaagagcatgtcacctcgacactgttt
gtctgctgggcggtacaggccgcgctgaatattctctatggtatccccaaacaaacgcgc
cagcacaaactgtctggcgtgtatgagcaccagatcctgcatccgcatgcattgctgaca
cgtggttttgatgacaacttcctcgctccgcattcgcgctatgccgactttcccagccaa
ctgatccgtgattacaccgatctggagctgtttgccgaatcggagagcaccggggcttat
ctgatggcgagcaaagataaacgtctggcatttgtcaccggtcatccggaatacgatgca
ctgacgctatcaggggaataccatcgtgactacgatgccggactgaatcccgaagtgcct
tttaactatttccctcatgacaacccggagttgccgccgcgcgccacctggcgtagtcac
ggcaacctgttgttctctaattggctgaactattacgtttaccagatcacgccgtttgat
ctacgacatatgaatccgacactcgaataa

DBGET integrated database retrieval system