KEGG   Pantoea sp. At-9b: Pat9b_0228Help
Entry
Pat9b_0228        CDS       T01386                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00620  Pyruvate metabolism
pao00630  Glyoxylate and dicarboxylate metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01200  Carbon metabolism
Module
pao_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pat9b_0228
   00630 Glyoxylate and dicarboxylate metabolism
    Pat9b_0228
Enzymes [BR:pao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pat9b_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADU67554
UniProt: E6WI40
Position
275598..277196
Genome map
AA seq 532 aa AA seqDB search
MTDSVISSTLTFSQPFTHAEKQLLTPEAIDFLHSLVARFAPERDRLLKARQQRQQRYDQG
ALPGFDLETSSIRESAWQVRPIPELLRDRRVEITGPPDRKMVINALNANVKVFMADFEDS
LAPTWQKLVDGQLALRDAVRGTLSFTSEAGKIYQLRSDPALLMCRVRGLHLDEKHVEWRD
RAIPGGLFDFALYLFHNVDALLEKGHGPWFYLPKTEHASEVAWWREIFRFSEDRFDLPRG
TIKATVLIETLPAVFQMDEILWELRDHVVGLNCGRWDYIFSYIKTLGQHGERILPDRQQI
SMDQPFLDAYSRLLIKTCHRRGALAMGGMSALIPSKDEERNVWVRQKVQEDKAREAANGH
DGTWVAHPGLADIAMAEFDRQLGDRPNQLHVSREQDNPITAERLLLPCRGKRTEAGMRAN
IRVALQYLESWISGNGCVPIDGLMEDAATAEIARTSIWQWIHHKQILSDGQLVTSALFEQ
LLDEELHALQHSLGEERFRNGRFADAAALMAQITTDDELVPFLTLPGYRLLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcggttatcagcagtacgctaaccttcagccagccctttacccacgcggaa
aagcagctgcttaccccggaagcgatcgacttcctgcactccctggtggcgcgttttgcc
ccggaacgcgatcgcctgttgaaagcccgccaacagcgacagcaacgttatgatcaaggt
gctttaccaggctttgatttggaaacgtcttccattcgtgaaagtgcatggcaggtacgt
ccgattcccgagctactgcgcgatcgtcgtgttgagatcaccggtccaccggatcgcaaa
atggtgatcaacgccttgaacgccaacgtaaaagttttcatggcggactttgaggattcg
ctggcacccacctggcaaaaactggtcgatggtcagttggcgctacgtgatgcggtgaga
ggcacgctgagtttcaccagtgaagcgggcaagatctaccagttacgttccgatccggcg
ttgctgatgtgccgcgtgcgtggcctgcatctggacgagaaacatgtggaatggcgtgac
cgtgccatccctggcgggttgttcgattttgcgttgtatctgtttcacaacgttgacgcg
ctgctggagaaaggccatgggccgtggttctatctgccgaaaaccgagcatgcctcggaa
gtggcatggtggcgtgaaatcttccgtttcagtgaggatcgtttcgatctgccacgcggc
accatcaaagccacggtattgatcgagacactcccggcggtgttccagatggatgagatc
ctgtgggaactgcgcgatcacgtggtcggtctgaactgcggccgttgggattacattttc
agctacatcaaaaccctcggacagcatggcgaacgcatcctgccggatcgtcagcaaatc
agcatggatcagcctttccttgatgcctattcgcggctgctgatcaaaacctgtcatcgc
cggggcgcgttggcgatgggcggcatgtcggcgctaatcccgagcaaagacgaagaacgc
aatgtctgggtgcggcagaaggtacaggaagataaggcccgcgaggcggcgaacggccac
gacggcacctgggtcgcccatcctggattggcggatatcgcgatggcggaatttgatcga
caactcggcgatcggcctaaccagttgcatgtcagccgcgagcaggacaacccgatcacc
gccgagcgtctgttgcttccctgtcgtggcaaacgtaccgaagcgggcatgcgcgctaac
atccgggtagcactgcaatatctggagtcgtggatcagcggcaacggctgtgtgcctatt
gatggcctgatggaagacgccgccaccgcagaaattgcccgtacctcgatctggcaatgg
attcaccacaagcaaatcctcagcgatggtcagctggtgacgtctgcgttgtttgaacaa
ctgttagacgaagaactgcatgcgttacagcacagcctcggcgaagaacgtttccgtaac
ggacgttttgctgatgcggctgcgctgatggcgcaaatcaccaccgatgatgaactggtt
cctttcctcaccctgccaggttaccgcctgctgccatga

DBGET integrated database retrieval system