KEGG   Pantoea sp. At-9b: Pat9b_0475Help
Entry
Pat9b_0475        CDS       T01386                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00520  Amino sugar and nucleotide sugar metabolism
pao00550  Peptidoglycan biosynthesis
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_0475
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pat9b_0475
Enzymes [BR:pao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Pat9b_0475
Peptidoglycan biosynthesis and degradation proteins [BR:pao01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Pat9b_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ADU67801
UniProt: E6WIL2
Position
555539..556798
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTRLSGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLRDIDTTMKLLSQL
GAKVERNGSVHVDAREVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGAR
PVDLHITGLEQLGAEIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMSAATLATGTT
IIENAAREPEIVDTANFLNTLGAKISGAGTDKITIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKVLCRNTQPDTLDAVLAKLRDAGAEIETGEDWISLDMHGKRPKAVNVRTAPHP
GFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHIPELIRMGAHAEIESNTAICHGVETL
SGAQVMATDLRASASLVLAGCIAEGTTLVDRIYHIDRGYEHIEDKLKAMGANIERVSGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatttcgtgtgcaaggccctacccgtttgagtggtgaagtcaccatctccggg
gcgaagaatgctgcgttacctattctgtttgcagcactgctggctgaagagccggtagag
attcagaatgtgccgaaactgcgtgacatcgacaccaccatgaagctgctgagccagctg
ggtgcgaaagttgaacgtaatggttcggtacacgttgatgcgcgcgaagttaatgttttc
tgtgcgccgtatgacctggtcaaaaccatgcgtgcttctatctgggcgctgggtccgctg
gtcgcgcgttttggtcagggacaggtttctctgccggggggctgtgccattggcgcgcgt
ccggtcgatcttcacatcaccggccttgagcaactgggagcggagatcaaactggaagag
ggctatgttaaagcctccgttgatggccgtctgaaaggcgcgcatatcgtgatggacaaa
gtgagcgtgggcgccaccgtgactatcatgagtgcggcaaccctggcgaccggtacaacc
atcattgaaaacgctgctcgtgagccggaaattgttgatacggcaaacttcctgaacacc
ctgggtgcgaaaatcagcggtgcgggtacagataaaatcaccatcgaaggggtagagcgc
ctgggtggcggtgtgtaccgtgtactgccggatcgtatcgaaaccggtactttcctggtg
gccgccgcgatttcacgtggcaaagtgctgtgccgcaacactcagccggatacgctggat
gccgtgctggctaaattgcgtgacgcaggggcagaaatcgaaaccggtgaagactggatc
agcctcgacatgcacggtaagcgcccgaaagctgtcaacgtgcgtactgccccgcatccg
ggtttcccgactgacatgcaggcacagttcactctgcttaacctggtggcagaaggcaca
ggtgtgatcaccgagaccattttcgaaaaccgctttatgcatatccctgagctgattcgt
atgggcgcacacgcggaaatcgaaagcaacacggcgatctgtcatggcgttgaaacgctt
tccggtgcccaggtcatggcgactgatttacgtgcgtcggccagcctggtgttagcgggt
tgtatcgctgaaggcaccacgctggtggatcgtatctaccatatcgatcgtggttacgag
cacattgaagacaaactgaaagcgatgggtgcgaatatcgaacgcgtcagcggcgaataa

DBGET integrated database retrieval system