KEGG   Pantoea sp. At-9b: Pat9b_0659Help
Entry
Pat9b_0659        CDS       T01386                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00300  Lysine biosynthesis
pao00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pat9b_0659
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pat9b_0659
Enzymes [BR:pao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Pat9b_0659
Peptidoglycan biosynthesis and degradation proteins [BR:pao01011]
 Precursor biosynthesis
  Amino acid ligase
   Pat9b_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ADU67984
UniProt: E6W952
Position
768940..770427
Genome map
AA seq 495 aa AA seqDB search
MTDRNLRDLLAPWVPGAPARPLRDMTLDSRSAAAGDLFIAVAGHHADGRRFIPQAIAQGV
AAVIAEAEGEAIDGDIREIHGVPVIYLAQLPQRLSALAGRFYQQPAEKLKLIGVTGTNGK
TTTTQLIAQWANLLGETGAVMGTVGNGLYGQLVATENTTGSAVDVQHVLHDLVGQGATLA
AMEVSSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGDMQSYEAAKWLLFSEHQVGAAIIN
ADDEVGRRWLAKLPDAVAVTMADNLQPGCHGRWLKATAVNYHDGGAHICFSSSWGDGEFD
SRLMGAFNVSNLLLALATLLSLDYPLDALVSSATQLLPVTGRMEVFSAPDKPTVVVDYAH
TPDALEKALEAARLHCKGQLWCLFGCGGDRDKGKRPLMGAIAEQFADVVVITDDNPRSED
PQAIVNDILTGLLDPGRARVVAGRAQAVTNAIMQAKAEDIVLVAGKGHEDYQIVGNRRLD
YSDRDTVARLLGVMA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgacagatcgtaacctgcgcgacttactggccccgtgggtgccgggcgcgccggcgcgt
ccactccgtgacatgacactggacagccgctctgcggctgctggcgatctgtttatcgcc
gtggcgggccatcatgctgatggacgtcgatttattccacaggctattgctcagggcgtg
gcggccgtgattgctgaagccgaaggtgaggccattgatggcgatatccgcgagatacat
ggtgtcccggttatctatctggcgcagttgccgcagcgtctctcggcactggccggacgc
ttttatcagcaacctgctgaaaaactgaaattaattggtgtcactggcaccaacggcaaa
accaccaccacgcagttaattgcgcaatgggccaatttgctgggtgagaccggtgcggtg
atggggacggtgggcaacggtctgtacggccagctggtggcgacagagaacaccaccggt
tcggcggttgacgttcagcatgttctgcacgacctggtgggtcagggcgcaacgctggca
gcgatggaagtgtcgtcgcatggtctggtacagcatcgcgttgccgcgctgccgtttgcc
gctgcggtgttcaccaatctgagccgcgatcacctcgattatcacggtgatatgcaaagc
tacgaagctgccaaatggctgttgttctccgaacatcaggtgggggcggcgattatcaat
gcggatgacgaagtcggacgccgctggctggcaaaattgcctgatgccgtcgccgtgacg
atggcagataacctgcaacccggctgccatggccgctggttgaaagccaccgccgtgaat
tatcacgatggtggtgcgcatatctgcttcagctccagttggggtgatggcgagttcgac
agccgcttgatgggcgcttttaacgtcagcaatctgctgctggcgctggcaacgctgttg
tcgctggattatccgctggatgctctggtcagtagcgcaacgcagttgctgcccgtcacg
ggacgtatggaagtgttcagcgcgccagacaaacccacggtggtggttgattatgcccat
acgccggatgcgctggagaaagcgctggaagcggcgcggctgcactgtaaaggtcaactg
tggtgcttgtttggttgcggcggcgatcgcgataaaggcaaacgcccgctgatgggtgcc
attgcggagcagttcgctgatgtggtggtgatcaccgatgacaatccgcgcagcgaagat
ccgcaggcgatcgtaaacgatattttaaccgggctgctcgatcctggtcgtgctcgtgtg
gtagcggggcgtgcgcaggcggtcaccaacgcgattatgcaggccaaagccgaggatatc
gtgctggtggcaggcaaagggcacgaagattatcaaatcgttggcaatcgccgtctggat
tactcagaccgcgacacggtcgcgcgtttgctgggggtgatggcatga

DBGET integrated database retrieval system