KEGG   Pantoea sp. At-9b: Pat9b_0724Help
Entry
Pat9b_0724        CDS       T01386                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00790  Folate biosynthesis
pao01100  Metabolic pathways
Module
pao_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pat9b_0724
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pat9b_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ADU68049
UniProt: E6W7S7
Position
complement(844881..845360)
Genome map
AA seq 159 aa AA seqDB search
MTRVYLALGSNLADPLHQVDAALAALDALPHTTRVATSSLYRTPPYGPPDQPDYLNAVVA
LETELPAETLLDHTQRIELEHGRVRKAERWGPRTLDLDILLFGDAVINTPRLTVPHYDMH
NRAFMLLPLLEIAPQQTLPDGTPLAPLLAALDQSAIRFW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtctatctcgcgttaggcagtaacctcgccgacccgctgcatcaggtagat
gcagcgctggcggcattggatgcactgccgcacaccacccgcgttgccacgtcgtcgctg
taccgcacgcctccctacggcccgccggatcaacccgattacctcaacgcggtggtggcg
ctggaaacagagctgcccgcagaaaccctgctcgaccatacccagcgcatcgagctggaa
catggccgggtgcgcaaagcggagcgctgggggccacgcaccctcgatctggatattctg
ctgtttggcgatgcggtgattaacacgccgcgcctgacggtgccgcattacgacatgcac
aaccgcgcatttatgctgctgccactgctggagattgctcctcagcagaccttacccgat
ggcaccccgttagccccgctgctggcggcgctcgaccaaagcgcgattcgtttctggtaa

DBGET integrated database retrieval system