KEGG   Pantoea sp. At-9b: Pat9b_0811Help
Entry
Pat9b_0811        CDS       T01386                                 

Definition
(GenBank) Acireductone dioxygenase (Fe(2+)-requiring)
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00270  Cysteine and methionine metabolism
pao01100  Metabolic pathways
Module
pao_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pat9b_0811
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Pat9b_0811
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Pat9b_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1
Motif
Other DBs
NCBI-ProteinID: ADU68135
UniProt: E6WAL0
Position
940656..941198
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTDTEASQPVWHSTDAAAIRERLNAKGVRFERWEADRDLGANPDSDTVINAYQH
AIDRLVAEKGYQSWDVLSMRADNPQKEVLRSKFLNEHTHSEDEVRFFVEGSGLFCLHLDG
QVYQILCEKQDLISVPAGTPHWFDMGSEPHFTAIRIFDNQEGWIANFTGDSIADAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgaccatttttaccgataccgaagccagccagccggtgtggcacagtacc
gatgcagcagcgattcgcgagcgtctgaacgccaaaggcgtgcgttttgaacgctgggaa
gcggatcgcgatctgggtgccaacccggattccgacacggtgatcaacgcgtatcagcat
gcgatcgatcgcctggtagccgagaaaggttaccagagctgggatgtattgagcatgcgt
gccgacaacccgcagaaagaagtgctgcgcagcaagtttctcaacgaacatacccatagc
gaagatgaagtgcgtttctttgtcgagggttcaggtctgttctgcctgcatcttgatggt
caggtgtatcagattctgtgcgaaaaacaggacctgatttcggtgccggcaggcacgccg
cattggtttgatatgggttctgagccgcactttaccgccatccgtattttcgacaatcag
gaaggttggattgcgaacttcacgggcgacagcattgcggatgcctatccgcgtctggcc
tga

DBGET integrated database retrieval system