KEGG   Pantoea sp. At-9b: Pat9b_1087Help
Entry
Pat9b_1087        CDS       T01386                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00520  Amino sugar and nucleotide sugar metabolism
pao01100  Metabolic pathways
pao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_1087
Enzymes [BR:pao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Pat9b_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 PGM_PMM_I
Motif
Other DBs
NCBI-ProteinID: ADU68409
UniProt: E6WAY6
Position
complement(1226804..1227952)
Genome map
AA seq 382 aa AA seqDB search
MYALVNGRIFTGHEILDNHAVVIADGLIERVCPRDALDATLPQQDVAGAFIAPGFIDLQL
NGCGGVQFNDDIDALSVETLEIMQRANEKSGCTSYLPTLITSTDELMQRAVETMRAYLNK
HQNQALGLHLEGPWLNKVKKGTHNPELIRLPDAKLVDFLCANADVITKVTLAPENAGSAV
IRQLRDAGIIVSAGHSNATYEEAKSGFAAGVSFATHLYNAMPTFAGREPGLIGALFDAPD
VYCGIIADGLHVHYANVRNAKRIKGDKLVLVTDATAPAGASIDKFIFAGKTIYYRNGLCV
DENGTLSGSAITMIETVQNCVEHCGIALDEALRMATLYPAKAMGVEKQLGTVEAGKVANL
TVFTRDFQIIKTFVNGENVLSE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcattagttaacggccggatttttaccggtcacgaaattctggacaatcatgcg
gtagtgattgccgatggcctgattgagcgcgtctgcccacgcgacgcgctggatgccacc
ctgccgcaacaggatgttgcgggtgcgtttatcgctcccggttttatcgatttacagctc
aacggctgcggcggcgtgcaatttaacgatgatatcgatgcattgagcgtggaaacgctg
gaaattatgcagcgcgccaatgagaaatcgggctgcaccagctacctgccaaccttgatc
accagcacggatgaattgatgcagcgtgctgtcgaaaccatgcgcgcgtatctgaacaaa
catcaaaaccaggcgctgggtctgcacctcgaaggtccgtggctgaataaagtaaaaaaa
ggcacgcataacccggaactgatccgtttaccggatgcaaaactggtggattttctctgc
gcgaacgccgatgtgatcaccaaagtgacactggccccggaaaacgccggaagtgcagtg
atccgtcaattacgcgatgcgggcattatcgtttcagcgggtcactcgaacgccacctat
gaagaagccaaaagcggtttcgcggcgggcgtcagctttgcaacccacctttacaacgcc
atgccgacctttgccgggcgcgaaccgggcttgattggcgcgctgtttgatgcgcctgat
gtatactgcggcatcattgcagatggtttacatgtccactacgctaatgtgcgcaatgcg
aagcgcatcaagggcgacaagctggtactggtaaccgacgccaccgcaccggcaggtgct
tcgattgataaatttatttttgctggcaaaacaatatactatcgcaatggcctttgtgtg
gatgagaacggcaccttaagtggctccgccatcaccatgattgaaacggttcagaattgc
gtggaacattgcggcattgcgctggatgaagctctgcgcatggcaacgctctatccggca
aaggcgatgggggtggaaaaacagttgggcacggtcgaagctggaaaagtcgccaacctg
actgtctttacccgcgattttcaaatcattaagacgttcgtcaatggagagaacgtcctc
agcgagtaa

DBGET integrated database retrieval system