KEGG   Pantoea sp. At-9b: Pat9b_1369
Entry
Pat9b_1369        CDS       T01386                                 

Definition
(GenBank) protein of unknown function DUF1047
  KO
K09911  uncharacterized protein
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Pat9b_1369
SSDB
Motif
Pfam: MatP MatP_C RHH_4 PRP1_N TMF_TATA_bd
Other DBs
NCBI-ProteinID: ADU68690
UniProt: E6WCD0
Position
1542969..1543436
AA seq 155 aa
MKYQQLENLESGWKWKYLVKKHREGELITRHLELSAAQAAVDTLLTMENSPVDVNDWIAQ
HIHPDLDNRLKQTIRARRKRHFNAEHQHTRKKSIDLEYLVWQRLAGLAQRRSSTLSETIV
QLIEDAERKEKYASQMSTLKQDLQAILGKGDTGNE
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaaataccagcagctcgaaaatcttgaaagtggatggaagtggaaatacctggtgaaa
aaacatcgggaaggtgaactgatcacccgtcatctggagctgagtgctgcacaggctgcg
gtggatacgctgctgacgatggagaacagccctgtcgacgtcaacgattggattgcccag
catattcatcctgatttggataatcgtcttaagcagaccatccgtgctcgtcgtaagcgc
cactttaatgcggagcatcagcatacccggaagaaatcgatcgatttggagtatctggtg
tggcaacgcctggcgggcctggcgcagcgtcgtagcagtacgctttctgaaactattgtg
cagttgattgaagatgcggaacgtaaagagaagtacgccagccagatgtcgacgttgaaa
caagatctccaggctattctgggtaaaggtgacaccgggaacgagtaa

DBGET integrated database retrieval system