KEGG   Pantoea sp. At-9b: Pat9b_1653Help
Entry
Pat9b_1653        CDS       T01386                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00480  Glutathione metabolism
pao00590  Arachidonic acid metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Pat9b_1653
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pat9b_1653
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pat9b_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADU68969
UniProt: E6WCK7
Position
1832035..1832577
Genome map
AA seq 180 aa AA seqDB search
MSIYQTELVTLDGEKTTLEQWQGKVLLVVNVASKCGLTPQYEQLEALQKAWQSQGFSVLG
FPCNQFLEQEPGSSEEIKTFCSTTYGVTFPMFEKTDVNGPARHALYSALVAAQPEALRPE
GSGFYERMVSKGRAPKAPGDILWNFEKFLINKQGEVVARFAPDMTPDDATLVARIKQALA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatcaaacagaactggttacgcttgacggtgaaaaaaccaccctggaacag
tggcagggtaaggtgctgctggtggtgaatgtcgcctcaaaatgtggcctcacgccgcaa
tacgagcaactggaagcgctgcaaaaggcgtggcagtcacaaggcttcagcgtccttggt
tttccgtgtaatcagtttctggagcaagagccgggtagcagcgaagagatcaaaaccttc
tgtagcaccacctacggcgtcacgttccccatgtttgaaaagaccgatgtgaatggtccg
gcgcgccacgcactgtacagcgccctggtggcggcccagccggaagcgctgcgtccggaa
ggcagcggtttttatgagcgtatggtgagcaaaggccgtgcgccgaaagcaccgggcgat
atcctgtggaatttcgaaaaattcctgatcaataagcaaggtgaagtggttgcgcgtttc
gcgccggatatgacgccggacgatgccaccttggttgcccgtattaaacaggccctggcg
taa

DBGET integrated database retrieval system