KEGG   Pantoea sp. At-9b: Pat9b_1798Help
Entry
Pat9b_1798        CDS       T01386                                 

Definition
(GenBank) ketose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00030  Pentose phosphate pathway
pao00051  Fructose and mannose metabolism
pao00680  Methane metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01230  Biosynthesis of amino acids
Module
pao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_1798
   00030 Pentose phosphate pathway
    Pat9b_1798
   00051 Fructose and mannose metabolism
    Pat9b_1798
  09102 Energy metabolism
   00680 Methane metabolism
    Pat9b_1798
Enzymes [BR:pao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Pat9b_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADU69114
UniProt: E6WEH4
Position
1995072..1995914
Genome map
AA seq 280 aa AA seqDB search
MKLYNFTDLLQVAKQREFKALGSFNLHCLEMLPAYFKAAEKTNSPLMIQISTGTAKYLGH
KLLVDAIRSLAESRNVPTCLHLDHCSDLDAIQTALDAGFSSVMYDGSHLPIEENISNTRK
VIDMARPLHVSVEAELGAIGGSEDGKSVEMNETSFTTVDDAKRFVDETGVDMLAISIGTV
HGLYTGKAHIQHQRLAAITEATHTPLVLHGGTGVSDEDMRLAVRSGIEKVNVGTEMNVQW
VARCKQTFEKGKVNDSVRNFLVPANDAVTDVLVEKIQLFR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttataactttaccgatctgttacaggtggccaaacaacgtgaatttaaagcg
ctgggttcctttaatttacactgtctggagatgttaccggcttattttaaagcggccgaa
aaaaccaatagtccattgatgattcagatctcaaccggcacggcgaaatatctcggccat
aaattattggttgatgcgattcgctcactggcggaaagccgcaatgtgccgacctgttta
catctggatcactgttccgaccttgatgcgattcaaaccgcactggatgccggtttcagt
tcggtgatgtacgacggttcacatctgccaattgaagagaatatttccaacacgcgcaaa
gtcattgatatggcacgcccgctgcatgtttcggtcgaagcggaactgggggcgatcggc
ggttctgaagatggtaaatcggtggagatgaacgaaacctccttcaccacggtggacgat
gcgaagcgtttcgtcgatgaaaccggggtagacatgctggcgatctcgatcgggacggtg
catggtctgtacaccggcaaagcacatatccaacatcagcgactggcggctatcaccgaa
gcaacgcatacgccgctggtgctgcacggcggcaccggcgtcagcgatgaagatatgcgt
ctggcggtgcgtagcggcatcgaaaaggtgaacgtcggcacagaaatgaatgtgcaatgg
gtcgcgcgctgtaaacagaccttcgaaaagggcaaagtcaacgacagcgtgcgtaatttc
cttgtgcccgcgaatgatgcggtgaccgacgtattagtcgaaaagattcagttattccgc
taa

DBGET integrated database retrieval system