KEGG   Pantoea sp. At-9b: Pat9b_1944Help
Entry
Pat9b_1944        CDS       T01386                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00330  Arginine and proline metabolism
pao01100  Metabolic pathways
Module
pao_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pat9b_1944
Enzymes [BR:pao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pat9b_1944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU69260
UniProt: E6W9Z0
Position
2152162..2153103
Genome map
AA seq 313 aa AA seqDB search
MSINLRGSERLNRAFTGIPTFLRADYCASLSELNATVAVFGVPFDEGSPWQPGTRFAPRS
IREHSMRFAPTGFFDIDRQQHFLTDVVTQGRLVDVGDVDVLPTNVIGTHDNISAMTQLIR
QRQAIPVAIGGDHSVSWPLIRGIQEPLHVVQFDAHLDFAPVTNGVHYSNGQPFRHIMALE
QVQSLTQIGIRSRRVRPSEFSDARAQGSTIITQQQFRQHATDALFTHLPAGEKCYISIDI
DVLDMALVPGCASAEPNGMHYDELLQSLLALMARMEVVGIDLVEVNPQLDVATGVTSYLA
AHLLVEMLGHLLQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaatttgcgcggcagcgaacggctcaaccgcgcgtttaccggcatccccacc
tttttgcgcgctgactattgcgccagcctgagcgagttgaatgcgacggtggcggtgttt
ggcgtcccctttgatgaaggttcgccctggcagcccggcacccgttttgccccgcgcagc
attcgtgaacactcgatgcgcttcgcgccaacgggttttttcgatattgaccgccagcaa
catttcctcaccgatgtggtgacgcaagggcgtttggtggatgtcggtgatgtggatgtg
ctgcccaccaatgtgatcggtacccatgacaacatcagtgccatgacgcagttaattcgc
cagcgtcaggcgattcccgtagcgatcggcggcgatcattcagtgtcctggccgctgatt
cgcggcatccaagagccgctgcatgtggtgcagttcgatgcccatctcgatttcgcgccg
gtgaccaacggggtgcattacagcaacgggcagcccttccggcatattatggcgctggag
caggtgcaaagcctgacgcagattggcattcgcagtcgacgtgtgcgtccctcggaattc
agcgatgccagggctcagggcagtaccattatcacgcaacaacagtttcgccagcacgcc
acggacgcgttgtttacccatctgcccgccggagaaaaatgttatatcagcattgatatt
gatgtgctggatatggcgctggtgccgggctgtgcctccgctgaacctaacggcatgcac
tatgatgagctgctccagtccctgctggcactgatggcgcggatggaggtggtgggcatc
gacctggtggaggttaacccacagctggatgtcgctaccggggtcacctcttaccttgcc
gcgcatctgctggtggagatgctcggccacctgctgcaataa

DBGET integrated database retrieval system