KEGG   Pantoea sp. At-9b: Pat9b_2510
Entry
Pat9b_2510        CDS       T01386                                 

Definition
(GenBank) FHA domain containing protein
  KO
K07169  FHA domain-containing protein
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Pat9b_2510
SSDB
Motif
Pfam: FHA UreE_N
Other DBs
NCBI-ProteinID: ADU69811
UniProt: E6WEU8
Position
complement(2739776..2741581)
AA seq 601 aa
MRFTIITTKPGHQPPQTLFDFLPPGGTIGRGVDNNLVLPDDDRTISRLQAIVHISADGEC
RLTNRGNVTRVLLNDIPLERGRQVELQDGDILGIDDYQLLVNDMHAASSASAVAKPAAKA
AITADEPPAVVSSNTAAIPSEIWDSLAKEFSISDDLSQRNKPAPAPAEAHPLTAPAAVER
NPEDPLAALISDAPLDIGQQPTNRSLFDEGDALFAQDSIFDDATPSALVGQKSAAASVPV
ENKPDELDPLSLFGSQNTPDPRHHDDPLGLMMSGAVPLAQPEIPPLATAQPEAEPEPESK
PESEPAAVTPAAVNLAELSSSPLFDDTDTAPAPIVAEEAEEPSAASPTPLEYGGITLPTP
QAVQRTPSPTPKGRLRIDPVASHSQREAAAQSSGDALKGELLDALLEGMGLQDLQPTPQF
DRDQMRQFGQMLSMFSQGTVALLSSRSILKRGVKADMTVILDDANNPFKLLPSGKTVLMQ
MFGSRMPGFMPPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPDQLEEEAREAGSV
SRLGLPGSRKAALWEHFVERYGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQTHTDD
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgcgctttacgataataacgactaaacccggccatcagccgccgcaaactctttttgac
ttcttaccccccggtggcaccattggtcgtggtgtggataacaatctggtattacccgat
gacgatcgtactatttcccgattacaggcaattgtgcatatttctgctgacggtgaatgc
cgtctgacgaatcgtggcaacgtcactcgcgtgcttttgaacgatattccattggaacgt
ggacgtcaggtggaattacaggacggcgatattcttggcattgatgattatcagttgctg
gtcaacgatatgcacgccgcatcgtcagccagtgcggtcgctaagccagcagccaaagcg
gcaatcaccgccgatgagccgcccgcagtggtcagcagcaacaccgccgctatccccagt
gagatctgggacagcctggcgaaagaattctccatctctgacgatttatcgcaacgcaat
aaacctgcgccagcgccagccgaagcccatccgttgacggctcccgctgccgtcgaacgc
aacccggaagatccgctggctgcgctgatcagtgatgcgccgctggatatcggccagcag
ccgactaatcgcagtctgtttgatgaaggtgatgcgttgtttgcccaggatagcattttt
gatgatgcgaccccgagcgcgctggtgggacagaagagtgctgcggcctctgtaccggtt
gagaacaagcccgatgagctggaccctctcagtctgtttggcagccagaacacccccgat
ccacgtcatcacgatgatccgttgggtttgatgatgagcggggcggtaccgctggcacaa
cccgagatccccccgctggcaacggcgcagccagaagcggaacccgagcctgagtcgaag
ccggagtcagagccagcggcagtcactcctgccgccgttaatctggcggaactcagcagc
tcaccactatttgacgataccgacactgcgccagcgccgatcgttgctgaggaagctgaa
gagccgagcgcagccagcccgacaccgctggaatatggtggcatcaccttgccgacgccg
caggcggttcagcgcactccatcaccgacaccgaaagggcgtctgcgcattgatccggtg
gcgtctcacagccagcgcgaggcggcggctcagagcagtggtgatgcgttgaaaggcgag
ttattggatgccttgctggaagggatgggcctccaggatttgcagcccacgccccagttc
gatcgcgatcagatgcgccagttcggccagatgctcagcatgttctcgcagggtaccgtc
gctttgctctcgtcacgttccattctcaagcgtggcgtaaaagcggatatgacggtcatc
ctcgacgatgccaacaacccgttcaaactgctgccttccggcaaaaccgtgctgatgcag
atgtttggcagccggatgcccggttttatgccaccacgccaggcggtacgtgatgcgttg
atcgatctccaggcgcaccagttagggatgatcgccggtatccgcgccatcatcgcgtcg
atgctgcaatcctttaacccggaccagctggaagaagaagcgcgcgaggccggttccgtg
tctcgccttggcctgccggggagtcgtaaggcggcgttgtgggagcattttgtcgagcgc
tacggcgaaaccgctggcgagatcgaagacgactttcacaccctgttcggcgaagctttc
ctgcacgcctacgacatggaagttaatcagtacaaagattcacaaacccacacggatgac
gcatga

DBGET integrated database retrieval system