KEGG   Pantoea sp. At-9b: Pat9b_2516Help
Entry
Pat9b_2516        CDS       T01386                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pao  Pantoea sp. At-9b
Pathway
pao03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pat9b_2516
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_2516
Secretion system [BR:pao02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pat9b_2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP FerB
Motif
Other DBs
NCBI-ProteinID: ADU69817
UniProt: E6WEV4
Position
complement(2744761..2745243)
Genome map
AA seq 160 aa AA seqDB search
MAIDMFLKVDGVTGESKDSNHTGWTDITSFNWGATQPGNMAVGGGGGAGKVNFNDLNVNA
LIDKSTSAILKYCANGKHVTKVELSICKAGGSQVEYARITLEDVLVSRVDYTGADNGDTL
SMAYSFQAAKVKQQYWEQSSSGGKGAESSAGWNIKENKEA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatatgtttttaaaagttgatggtgtgacgggtgaatctaaagattctaac
cacaccggttggaccgatattacctcctttaactggggcgcaactcaaccgggaaatatg
gcggttggcggtggcggcggtgcgggtaaagttaattttaatgatctgaatgtcaatgcg
ttgatcgataaatccacatccgccattctgaaatattgcgctaatggtaagcacgttacc
aaagttgagttgtccatttgcaaagcgggtggttctcaggttgagtatgcgcgtatcacc
cttgaagatgtactggtttcccgcgtagattataccggtgctgataatggcgatacactg
agcatggcttactcattccaggccgcgaaagtgaaacagcaatactgggagcagagctct
tccggtggtaaaggtgcagaaagcagcgcaggctggaatatcaaggaaaataaagaggcg
taa

DBGET integrated database retrieval system