KEGG   Pantoea sp. At-9b: Pat9b_2518
Entry
Pat9b_2518        CDS       T01386                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_2518
Secretion system [BR:pao02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pat9b_2518
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADU69819
UniProt: E6WEV6
Position
complement(2746958..2747488)
AA seq 176 aa
MATMKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKPLEPQAAVDD
RKFLEIDIDNFDERMKAMKPRAAFQVDNTLTGEGKLNVELTFESMDDFSPDAIARHVEPL
NKLLEARTQLANLLTYMDGKNGAEELIGKILHDPTLLQALTHLPKQADVAEGKEEQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atggccacaatgaaatccagcgggcagaaatttatcgcccgcaatcgcgcgccccgcgtt
caaatcgaatatgacgtggagatctatggcgcggaacgcaaaatccagctgccgttcgtg
atgggtgtgctggcagacctcgctggcaagccactggaaccgcaggctgccgtcgatgac
cgtaaattccttgagatcgatattgataactttgacgagcgcatgaaggcgatgaaaccg
cgtgcggcgtttcaggttgataacaccctgacgggtgagggcaaactcaatgtcgaactg
accttcgaaagcatggatgacttctcgcccgatgcgattgcccgccacgtggagccactg
aacaagctgctggaagcacgtacccagcttgccaacctgttgacttatatggatggcaaa
aacggtgcggaagagttgattggcaaaattctgcatgacccgacgctgttgcaggcgctg
acgcatctgccgaagcaggccgacgtggcagaaggtaaggaggaacaataa

DBGET integrated database retrieval system