KEGG   Pantoea sp. At-9b: Pat9b_2522
Entry
Pat9b_2522        CDS       T01386                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
pao  Pantoea sp. At-9b
Pathway
pao03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pat9b_2522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_2522
Secretion system [BR:pao02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pat9b_2522
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: ADU69823
UniProt: E6WEW0
Position
complement(2752942..2754180)
AA seq 412 aa
MQPQQKPNSDAAQPDVSHQNVLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRHFE
LSCQQSGLSYEVIIGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQ
LLAKLSQNPRQHILLLELIYFCLLLGFEGRYRVLDNGRSQLETIKQRLLQMIKSVRGSYA
AALSVHPTDQPVLRKLWRPMIPLWAFAAVAALGACLFYIILNWRLGDYTTPVLANIYQTS
LPEMQIRNPAPPPPAALNLKTFLKPEIDAGLVAVRDEADQSVVTLKGDGLFTSGATTVRG
RYEAVIQRIAAAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQSVQTLLQQQLTQ
PARVKAEGRGESNPLVPNTSAENRARNRRVEITLLVAPDATQAELNGLARGN
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcagccacaacagaaaccgaatagcgatgccgcacagcccgatgttagccaccagaat
gtgttggtggcggcggccaacccgctgattaacgccatcccgcagatccggcactccgtt
tcccatgacgatcccgcgcgtctgcgtcagcaattgattgatcagatccgtcactttgaa
ctgagttgtcagcagtcgggcctgagttatgaagtgatcattggtgcgcgttactgcctg
tgcaccgcgctggatgaagccgccgcactgacgccctggggcagtcgtggcgtctggacc
agcaacggtttgctggtcacttttcacaatgaaacctggggcggggagaagtttttccag
ttgctggccaaactgtcgcagaatccgcgtcagcatatcctgttgctggaattgatctac
ttttgcctgctgctcggttttgaagggcgctatcgggtgctggacaacgggcgctcgcag
ctggaaaccatcaaacaacgactgttgcagatgatcaaaagcgtgcgcggcagctatgcg
gcggcactgtcggtgcatccgaccgatcaaccggtgttgcgcaagttgtggcgtccgatg
atcccgctgtgggcctttgctgcggtggcggcgctcggtgcctgtctgttctatatcatt
cttaactggcggctgggtgattacaccacgccggtactggccaacatctatcaaacctca
ttaccggaaatgcagatccgtaatccggcaccgccgccgcctgctgcgcttaatctgaaa
actttcctcaagccggaaattgatgccggtctggtggcggtgcgtgatgaggccgatcaa
agcgtcgtgacgctgaaaggggatggcttgttcacctccggcgcgaccacagtgcgtggc
cgttatgaagcggttatccaacgtattgcggcggcgatgaataacgtcagcggcaagatt
ctggtggtgggttacagcgataacgttccgatccgcagcgcccgttttgcttccaactat
gaactctccctggcacgcgctcagtcggttcaaaccttgttgcaacagcaactcacccaa
ccggcacgcgtgaaagcagaagggcgcggcgagagcaatccgctggtgccaaataccagt
gccgagaaccgtgcgcgtaaccgccgtgtggagatcacgctgctggtggcaccggatgcg
acgcaagctgaacttaacggcctggcgagagggaactaa

DBGET integrated database retrieval system