KEGG   Pantoea sp. At-9b: Pat9b_2624Help
Entry
Pat9b_2624        CDS       T01386                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00511  Other glycan degradation
pao00520  Amino sugar and nucleotide sugar metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_2624
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pat9b_2624
Enzymes [BR:pao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pat9b_2624
Chaperones and folding catalysts [BR:pao03110]
 Intramolecular chaperones
  Others
   Pat9b_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX CHB_HEX_C Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ADU69924
UniProt: E6WFL0
Position
2876051..2878714
Genome map
AA seq 887 aa AA seqDB search
MKTLQLSFLALSMMGITACSAVPHNQQQVVDQISQFGVQYQITDNQAASHGVDCAQLGAD
WASCNRATIKLTNHGPAITSKNWAIYMSNVHETLRVDNDQFKMTHIVGDLTRLEPTDKFT
GFAAGATVDIPIVNEYWQLFITDVMPRWYVSAEGASPKIITSTNTENLADFVLPFGDQWK
RTADDKNVLMQPTSRFAKNADINLLPAASLRGQITPTPRAVKIHTADVDLSQGVTLRLDT
LPTNQAAAVQQRFYLLGIHQNPTGYGITTQIDARHFQGEEAVSGAYQLNITPRGTDIVGY
DTAGVFYGLMSLLSLIPAEGKPVIATLEAQDAPRFAYRGAFLDVARNFHSKQAVLTMLDQ
MAAWKMNKFHFHLSDDEGWRIEIPGLPELTDVGSKRCHDLSEQRCLVPQLGSGPFSDNNG
SGYFSRADYIDIVKYAQARNIEVIPEIDMPAHARAAVIAMEARYNALMKAGKPLEASEFR
LVDPTDSSNTTSVQLYDRTSYLNPCLDSSQRFVDKVIGEIQRMHREAGQPLTTWHFGGDE
AKNIRLGAGYTDSKHPEPGKGILDQSKEDKPWAKSQVCQALVKSGKVQDLEHLPSHFALE
VSQLVKAHGIPVMQAWQDGLKDAANAQAFATSRTRVNFWDTLYWGGFASANDWTQKNYDV
IISNPDYVYMDFPYEVNPLERGYYWGTRFSDERKMFSFAPDNLPQNAETSVDRDGNTFAT
TSEKPWGGAYGLSAQLWSETVRTDQQMEYMIFPRLLSVAERGWHRANWELDYQQGRNFKG
GETHHVNQRQLNRDWQRFANLLGQRELGKMDKAGIHYRLPVPGARIVEGKLEMNVALPGL
PLQYSIDNGSNWLDYNPQIHPEIGANDKVMVRSLSPDGKRTSREEML
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttacagttaagctttctggcactcagtatgatgggcatcaccgcctgtagt
gccgtaccgcacaatcagcagcaagtcgtggaccaaatcagccagttcggggtgcagtac
caaatcaccgataatcaggccgccagccatggcgtagattgcgcgcaactgggcgctgac
tgggcatcgtgtaaccgggcgaccatcaaattaaccaaccatggcccggccatcaccagc
aaaaactgggcgatttatatgagcaacgtgcatgagacgctgcgcgttgataacgaccag
tttaagatgacgcatattgtcggagatttaacccggctggaacccaccgataagttcacc
ggctttgccgccggagcaacggtagacattcctatcgtgaatgaatactggcaattgttt
attaccgatgtgatgccccgctggtacgtcagcgcagaaggtgcatcccccaagattatc
accagcaccaacaccgaaaatttagccgatttcgtgctgccgtttggcgatcaatggaaa
cgcactgctgatgataaaaacgtactgatgcagcccaccagtcgcttcgcgaaaaatgcc
gatatcaacctgctgccagcggcttcattacgtgggcaaattacgccaacgccacgcgcg
gtgaaaatccatacggctgatgttgacctgagccagggcgtcacactccggttggatacc
ctgccgaccaaccaggcggcggcggttcaacaacgtttttacctgttggggattcatcag
aacccaacaggatatggtattacgacgcaaattgatgcccggcacttccagggcgaagag
gcggtgtcgggcgcttatcagttaaacatcaccccacgcggtactgatatcgtcggctac
gataccgcaggggttttctatgggctgatgtcgttgctgtctctgataccggctgaaggc
aaaccggtgatcgccacgctggaagcgcaggatgccccacgctttgcctatcgtggagcg
ttcctcgatgtcgcgcgtaatttccacagtaaacaagcggtgctcacaatgctggatcag
atggccgcatggaagatgaacaaattccatttccatttgagtgacgatgaggggtggcgc
attgaaatcccaggcctgccggaattgacggatgtcggcagtaaacgttgccacgatctg
agcgaacaacgctgtctggtgccgcaactcggttccggtccatttagcgataacaatggc
agcgggtatttcagccgcgccgactacatcgatatcgtaaaatatgcccaggcacgcaat
attgaagtgatcccggaaatcgatatgcccgcgcacgcccgtgcagcggtcatcgcaatg
gaagcgcgctataacgctctgatgaaggccggtaaaccccttgaagcgagcgaattccgt
ctggtcgatcccaccgatagttctaacaccacgtcagttcaactgtacgatcgcaccagt
tatctcaatccttgcctcgactcgtcgcaacgctttgtggataaggtgatcggtgagatc
cagcgtatgcatcgtgaagccggccagccgctgaccacctggcattttggcggcgatgaa
gcgaaaaacattcgccttggcgcaggttataccgacagcaaacatccggaaccgggcaaa
ggtattctcgaccagagcaaagaggacaagccttgggcgaaatctcaggtttgccaggct
ctggtgaagtccggcaaggtacaggatctggaacatctgccgagtcacttcgcgttggaa
gttagccagttggtgaaggcgcatggtatcccggtgatgcaggcatggcaggatggtctg
aaagatgcggccaacgcgcaggcctttgccacctcccgcacccgcgtgaatttctgggat
accctctactggggcggttttgccagcgccaacgactggacgcagaaaaattacgatgtg
atcatttccaatccagattacgtctacatggacttcccgtatgaggtcaacccgctggaa
cgcggttattactggggaacccgtttcagtgatgagcgtaagatgttcagtttcgcacct
gataacctgccgcaaaatgcggaaacatcggtcgaccgcgatggcaacacgtttgccacc
acctcggagaaaccctggggtggcgcttatggcctctctgcccagctgtggagcgaaacc
gtgcgtaccgatcagcagatggaatatatgatcttcccccgcctgctatccgtggctgaa
cgtggctggcatcgcgccaattgggagctggattatcagcaaggtcgcaactttaaaggt
ggcgaaacccatcacgtcaatcagcgacagctcaatcgcgactggcaacgttttgccaac
ctgctgggacaacgcgaactcggcaaaatggataaagccggtatccattaccgtttgccg
gtgcccggtgcccgcattgtagaaggcaagctggaaatgaacgtcgccctacccggtctg
ccgctgcaatacagtatcgataacggcagcaactggctggattataacccgcagatacat
cctgagattggcgctaacgacaaggtgatggtgcgtagtctcagcccagacggtaagcgg
accagccgcgaagagatgctgtaa

DBGET integrated database retrieval system