KEGG   Pantoea sp. At-9b: Pat9b_3106Help
Entry
Pat9b_3106        CDS       T01386                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pao03016]
    Pat9b_3106
Enzymes [BR:pao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Pat9b_3106
Transfer RNA biogenesis [BR:pao03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Pat9b_3106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADU70405
UniProt: E6WGC5
Position
complement(3408960..3409739)
Genome map
AA seq 259 aa AA seqDB search
MLEIIYQDEWLVAVNKPAGWLVHRSWLDRKEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEVGRLLAQQFEQHQIRKTYHAVLRGWLMESGTLDYPLVEELDKIADKFATEPR
GPQPAVTDFQMLAHTEMPVAIGRYATARYSLVEMQPRTGRKHQLRRHMAHLRHPIIGDTT
HGDLRQNRGAAANFGLDRLMLHASALSLNHPVTGEPLVIRAGLDTVWQQMLHQFGWQHQI
PDVPRVEFVDEAVQDKPTE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatttatcaggacgagtggctggtcgccgtcaataaacctgcgggttgg
ctggtgcaccgtagctggctcgaccgcaaagaaaaagtggtggtgatgcaaacggtgcgt
gatcagattggtcagcacgtttttaccgcccaccgcctggatcgtcctacctcgggcgtg
ttgttgatgggattgtcgagtgaggttgggcggctgctggcccagcaattcgaacaacat
caaatccgcaaaacctaccatgcggtgctgcgtggctggctgatggaaagcggtacgctc
gattatccgttggttgaggaactcgataagatcgctgataagttcgccaccgaaccccgt
gggccgcaaccggcagtcaccgattttcagatgctggcgcacactgaaatgccggtagcg
attggtcgttatgccactgcgcgttacagcctggtggagatgcaaccgcgtactggccgc
aagcaccagttgcgccgccatatggcacatctgcgccaccccattattggtgatacgact
cacggtgatctgcggcagaaccgtggcgcggcggcaaattttgggctggatcgtctgatg
ttgcatgccagcgcgctgagcctgaatcatccggttactggggaaccgctggtgatccgt
gccggtctggataccgtctggcagcagatgctgcaccagtttggctggcagcatcagatc
cctgatgttcccagggttgagtttgtcgatgaggcagtccaggataagccaacagaataa

DBGET integrated database retrieval system