KEGG   Pantoea sp. At-9b: Pat9b_3123Help
Entry
Pat9b_3123        CDS       T01386                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pao  Pantoea sp. At-9b
Pathway
pao03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pat9b_3123
Enzymes [BR:pao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pat9b_3123
DNA repair and recombination proteins [BR:pao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pat9b_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 DUF2075 UvrD_C AAA_28 PhoH DUF4277 CbiA AAA_16 T2SSE FtsK_SpoIIIE MukB AAA AAA_25 TrwB_AAD_bind SRP54 AAA_24 ResIII NTPase_1
Motif
Other DBs
NCBI-ProteinID: ADU70421
UniProt: E6WGE1
Position
complement(3424803..3426632)
Genome map
AA seq 609 aa AA seqDB search
MSSMTALLTQAMALRLLRPLDIQFACLLADDLQPARLLVAACLSAEAGEGHVCLPLSQLT
PEGLFNGRHPELAQAIWQAAGAPQDWQALFHDWHALSDGTQATPIILTQQRLYLHRLWQN
EGQVAHFFRTDVAPQQFAPERVRQVLDSLFGTQPEDWQKIAAAVALTQKTAVISGGPGTG
KTTTVAKLLAALIRLSTTPLRIQLAAPTGKAAARLTESLGKALRQLDVSNEERLCFPAEA
TTLHRLLGAQPETQRLRYHAGNPLHLDVLVVDEASMVDLGMMANLIAALPPQARVIFLGD
RDQLASVEAGAVLGDICRCGEAGYSPARAALLSQLTGCVVTGREDANAPLVRDAICLLRT
SYRFDAQSGIGQLAAAVNQGDAVAVERVFGAGFSDISRQTLSDADAYQAMLTQVAEGYRP
YLHLVAECAEPAAIIHAFGRYQLLCALREGPFGVQGLNQRIEQKLIQLQLIRRPTGGSRW
YQGRPVMVTRNDSALGLFNGDIGITLLDEEGLLKVFFPLPDGTIKAVQPSRLPAHDTAWV
MTVHKSQGSEFDHTALVMPAQFLPVLTRELIYTAITRARRQLTLYSDDGVFRRAVQLRTQ
RRSGLLERL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcatgaccgcgctgctgactcaggcgatggcgttgcgtttgttgcgccctctg
gatattcagtttgcctgcttgttggcggatgacctgcaaccagcacgcttgttggtggcg
gcttgtctcagtgcggaagccggtgagggccacgtttgcctgccgttatcacagctgacg
cctgagggattatttaatggtcgccatccggagctggctcaggccatttggcaggccgcg
ggtgctccccaggattggcaggcgttgtttcatgactggcacgcactgagtgatggcaca
caggccacccccattatcctgacgcaacagcggctctatctgcatcggttatggcagaac
gaaggccaggtcgcgcactttttccgcaccgatgtggccccgcagcaattcgcgccagaa
cgcgtgcgtcaggtactggactcgctgtttggcacgcaaccggaggactggcagaagatc
gccgccgcggtggcgttgacgcagaaaactgcggtgatttctggtggccctggcacgggc
aaaaccaccaccgtggcaaaactgctggccgcgctgattcgcctgagcaccactcctttg
cgtattcaactggctgcaccgaccggaaaagcggccgcgcgtctgaccgagtctctgggt
aaagcgctacggcagcttgacgtcagcaacgaagaacggctgtgcttcccggcagaagcc
accacgctgcaccgtctgttgggggcgcagccggaaacccagcgtttacgttatcacgct
ggtaatcccttgcatctggatgtgttggtggtggatgaggcttcaatggttgatcttggc
atgatggcgaatttgatcgccgcgctgccaccgcaggctcgggtgatcttccttggcgat
cgcgatcaactggcgtcagtggaagcgggggcggtgctgggcgatatctgccgctgtggg
gaagccggttacagtccggcacgggcggcgctactgagccaactcaccggctgtgtggtg
acgggcagggaggatgcaaacgcaccgttggtacgcgatgcgatctgcctgctgcgtacc
agctatcgctttgacgcccaatcgggcataggacagctggcagccgcagtcaatcagggt
gatgcggttgcggttgagcgcgtgtttggtgccgggttcagcgatatctctcgccaaacg
ctgagcgatgccgatgcctatcaggcgatgctgacgcaggtggctgagggatatcgacct
tacctgcatctggttgccgaatgcgccgaaccggcggcgattattcatgcctttggccgt
taccaactgttgtgcgcgttacgtgaagggccttttggtgtgcagggactgaaccagcgt
attgaacagaaactgattcagttgcagttaattcgccgaccgaccggtggcagccgctgg
tatcagggacgaccggtgatggtgacgcgcaacgatagcgctctggggctgtttaatggc
gacattggcattaccctgctggatgaagaagggctactgaaagtctttttcccgttaccg
gatggcaccatcaaagctgtgcaacccagccgcttgcccgcgcatgacacagcctgggtg
atgacggtgcataaatctcagggatcggagtttgatcataccgcgctggtcatgccggcg
cagtttttgccggtgctgacgcgtgaactgatttataccgccatcacccgcgcccgtcgt
caattgacgttgtacagcgatgacggggtatttcgccgcgcggtgcaactgcgcacgcag
cgtagaagtggcttgctggagaggctgtag

DBGET integrated database retrieval system