KEGG   Pantoea sp. At-9b: Pat9b_3258Help
Entry
Pat9b_3258        CDS       T01386                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00130  Ubiquinone and other terpenoid-quinone biosynthesis
pao00627  Aminobenzoate degradation
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01220  Degradation of aromatic compounds
Module
pao_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Pat9b_3258
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Pat9b_3258
Enzymes [BR:pao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Pat9b_3258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADU70554
UniProt: E6W8R4
Position
complement(3595716..3596294)
Genome map
AA seq 192 aa AA seqDB search
MSRRRIIVGISGASGFQYGMKALQLLRDQDIEVHLVVTKGAEVTRSMETAWQRQEITDLA
DEVHSISNLGASISSGSFKTLGMLIAPCSMNSLASIAHGLTGNLLTRAADVILKERRRLV
LMVRETPLNLVHIRNMAAVTEMGGIVYPPVPAFYQKPQSVDEMVHHSVSRALDLFDLDVG
NLKRWGEKHNEA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaggcgcattatcgtcggcattagtggtgcatccggttttcagtacggcatg
aaggcgctgcaattgctacgcgatcaggatattgaggtgcatctggtcgtgaccaagggc
gcagaggtgacgcgttcgatggaaacggcatggcagcggcaggagatcaccgatttggcc
gatgaggtgcatagcatcagcaacctcggtgcctcgatctccagcggctcgttcaaaacc
cttggcatgctgattgcgccctgctcaatgaactcgctggcgtccatcgcgcatgggctg
accggcaatctgctgactcgtgcagcggatgtgatcctgaaagagcggcgtcggctggtg
ctgatggtacgtgagacgccgctcaatctggtgcacatccgtaatatggcggcagtgacg
gaaatgggcgggatcgtgtacccgccggttccggccttttaccagaagccacaatccgtg
gatgaaatggtacatcacagtgtatcgcgcgccctcgatctgtttgatctcgacgtcggc
aacctgaaacgctggggtgaaaaacataatgaagcctaa

DBGET integrated database retrieval system