KEGG   Pantoea sp. At-9b: Pat9b_3375Help
Entry
Pat9b_3375        CDS       T01386                                 

Definition
(GenBank) Arogenate dehydratase
  KO
K01713  cyclohexadienyl dehydratase [EC:4.2.1.51 4.2.1.91]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01130  Biosynthesis of antibiotics
pao01230  Biosynthesis of amino acids
Module
pao_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pat9b_3375
Enzymes [BR:pao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Pat9b_3375
    4.2.1.91  arogenate dehydratase
     Pat9b_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ADU70669
UniProt: E6WD44
Position
complement(3719361..3720128)
Genome map
AA seq 255 aa AA seqDB search
MKTMLFSALLLVSGVAQAQSHLDQVRESKTLRVCTTGDYKPYSYLRSDGQYEGLDISMAQ
SLAESLGAKVQWVPTTWKTLSEDFVAQHCDIALGGVSVTLKRQQIAWFAQPLGVDGKIPL
VRCADKAKYQTIEQINQPQVRVIEPAGGTNEAFVHSHLPNASLTLFHDNVTIFQQLVDNK
ADVMITDASEALFQQKHYPQLCALNPDQPMQYGEKAYMIPRDDMSWKQYVDQWLHLSTAT
GDYARIAEQWLGVIK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatgttattcagtgcgttacttctggtcagcggcgtcgctcaggcgcaatct
caccttgatcaggtacgcgaaagcaaaacgctcagagtctgtaccaccggggattacaag
ccgtatagctatctgcgcagtgacgggcagtatgaagggttagatatcagcatggcgcag
tcgctggcggaaagcctcggtgccaaagtgcagtgggtacccaccacatggaaaaccctc
agcgaagattttgtcgcgcagcattgcgatatcgcgctgggtggcgtgtcagtcaccctg
aagcgccagcaaattgcctggttcgctcaaccactgggcgtggatggcaaaatcccgttg
gtgcgttgcgctgataaagcgaagtatcaaaccattgaacaaatcaaccagccgcaggtg
agggtgattgaaccggcaggtggcaccaatgaagcctttgtgcacagccatctgcccaat
gcttcgctgacgctgttccacgataacgtcaccatttttcagcagttggtggataacaaa
gccgatgtgatgatcactgatgcgtcggaagccttgttccagcagaaacactatccgcag
ctctgtgcacttaacccggatcaaccgatgcagtatggcgagaaggcgtacatgatcccg
cgtgatgatatgagctggaaacaatacgttgatcagtggctgcatctcagcaccgccacc
ggcgattatgcgcggatcgccgagcagtggttgggtgtgatcaaataa

DBGET integrated database retrieval system