KEGG   Pantoea sp. At-9b: Pat9b_3458
Entry
Pat9b_3458        CDS       T01386                                 

Definition
(GenBank) type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_3458
Secretion system [BR:pao02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pat9b_3458
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ADU70748
UniProt: E6WE60
Position
complement(3790283..3791860)
AA seq 525 aa
MTGIAVLISACGAEDVALRAEAEPRIHAWAGWIAPITDLAPTGQDPTYDDHFQQMLAEVN
KLSGVDTALIIALAEPLLISVSKDIRVITFYLWARLHQQGEQGLAEGLELLAAALQQYGE
LLHPQRPRSRQGALSWLSSGRMLNSLALWPAVDVTLIRRICAVLLRVHDLIREEERQALV
PLIQALEVRLARSGGADALVPQNSSAPTEADKNLTPMLAPISSGRDLLDQVRLLARYLRE
QPEGWLAAHHLMKSVRWDTLHHLPPLDASGRTRLAPPKPEHLAHLKRLWLQQRWQELLDL
TDSLFAQSVNHVWLDVQWYVWEALSRGNTDSRLATVVEQDLSALLLRLPGLECLTFSDGT
PFADEVTLSWIARQVKNDASYREPVAQSSASGQEGDLLALESEALTIADTEGAEAALCWL
QQRPGVTSQRARWLLRLLMARVCEQLAKHDMALHLLRELDRSAESLTLVHWSPELLFEVR
ARRLKLLRTRAARSESDKARLQSEMENLLAGLIALDPAHAAVLCR
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgacagggattgcggtgttaatcagcgcctgtggcgcagaagacgttgccttacgggca
gaagcagagccgcgtatccacgcctgggcgggctggatcgcgccgatcaccgatttggcc
cccaccgggcaagatccgacgtatgacgaccatttccagcaaatgcttgccgaggtcaac
aaactctccggtgtggatacggcgctcatcattgcgctggccgagccgttgctgatctca
gtcagcaaagatattcgtgtgatcacattttacctgtgggcgcggcttcatcagcaggga
gaacagggtctggccgaaggtctggaactgctggccgccgcattgcagcaatacggtgaa
ttgttgcatccgcagcggcctcgtagcaggcagggtgcattgagctggctcagcagcggc
agaatgctgaacagtctcgcactgtggccggcagtagatgtgacgctcatccggcgcatc
tgcgccgtgctgttgcgggtacatgacctgatccgtgaagaggagcgtcaggcgctggtg
ccgctgatacaggccctggaggtccgactggcgcgcagcggcggtgcggatgcgctggtg
ccgcaaaacagcagcgcaccgacagaggctgacaaaaaccttacgccaatgttggccccc
atttcgtcggggcgcgatctgcttgaccaggtcaggcttctggcacgttatctgcgtgaa
cagcccgagggatggcttgccgcgcatcatctgatgaaaagtgtacgctgggacacactt
catcatctgccgccactggatgccagcggccggacgcgtctggctcctccgaaacctgag
catctggcacatctgaaacgtctgtggttgcaacaacgctggcaggagctgctggacctg
accgattcactcttcgcgcaaagcgtcaatcatgtctggctggatgtgcaatggtacgtc
tgggaagcgctcagccggggcaacaccgactcccggctggcaaccgtggttgagcaggat
ttgtcggcgttgttattgcgtttgccgggcctggagtgtctgacattttccgatggcacc
ccttttgccgatgaagtgacgctgagctggatcgcccggcaggtgaaaaacgatgcttct
tatcgcgaacctgtcgctcagtcatctgccagtgggcaggagggagacctcctcgcgctg
gagagtgaggcgctgaccatcgccgatacggagggcgcggaagccgcactttgctggcta
cagcagcggcccggcgtcaccagccagcgtgcccgctggctactgcgtctgttgatggcg
agggtatgcgaacagctggctaagcacgacatggcgctacatctgttgcgtgaattagac
cgtagtgcggagagccttacgctggtgcactggtcgcctgaattgctgtttgaagtcagg
gccagacggctaaaactgctcagaacccgggcagctcgcagcgagagtgacaaagcccgg
ttgcaatccgagatggagaacttgctggccgggctgattgcccttgatccggcgcacgcc
gcagtactttgccgctga

DBGET integrated database retrieval system