KEGG   Pantoea sp. At-9b: Pat9b_3463Help
Entry
Pat9b_3463        CDS       T01386                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
pao  Pantoea sp. At-9b
Pathway
pao03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pat9b_3463
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_3463
Secretion system [BR:pao02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pat9b_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ADU70753
UniProt: E6WE65
Position
complement(3800156..3800836)
Genome map
AA seq 226 aa AA seqDB search
MSNNQQGGFVDIDALMQNSWLQVISLRHQPQFKEGEGKALWQRCVADIKQVQQVLRDAGT
GDESRQDILLAHCALLDEAVKGRGVQDDACMQWYHLPLQGHFLHSIDAGETLCDRMWQVL
RQPTADALVLMCFHRVMLLGFLGGYPSLQAAERQELVSALNARVPPYKHTTEQFLLTGTE
GSLQRRIVSHWPVRLGLSALLLLAVWWGLDRWLDQLIVVLLPEVTG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaccaacagggaggttttgtggatatcgatgcattgatgcagaacagctgg
cttcaggtcattagcctacggcatcagccgcagtttaaagagggagagggtaaagcgtta
tggcagcgttgcgtggccgatattaagcaggtacagcaggtactgcgcgatgcgggcacc
ggagatgaaagccgtcaggacatcctgctcgcacactgtgcattgcttgatgaagccgtg
aaggggcgaggggtgcaggatgacgcctgtatgcagtggtatcacctgccgcttcagggg
cattttctgcattccatcgatgccggtgaaaccctgtgcgaccgaatgtggcaggtactt
cgccagccaactgcggatgccttggtgttgatgtgctttcatcgggtgatgttgctgggg
ttccttggtggctatccatcgctgcaggcagcggaacgccaggagctggtcagcgcgctt
aatgcacgtgtgccgccgtacaaacataccaccgaacaattcctgctaaccggaacggag
ggcagtttgcagcggcgcatcgtaagtcactggccggtgcgtctggggttgtcagcatta
ctgttgttggcagtgtggtgggggctggatcgttggttggatcaactgatagtggtactg
ctaccagaggtgacgggatga

DBGET integrated database retrieval system