KEGG   Pantoea sp. At-9b: Pat9b_3701Help
Entry
Pat9b_3701        CDS       T01386                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00020  Citrate cycle (TCA cycle)
pao00620  Pyruvate metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
Module
pao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_3701
   00020 Citrate cycle (TCA cycle)
    Pat9b_3701
   00620 Pyruvate metabolism
    Pat9b_3701
Enzymes [BR:pao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Pat9b_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADU70991
UniProt: E6WH03
Position
4031904..4033526
Genome map
AA seq 540 aa AA seqDB search
MRVNGLTSHDLATLGINGTTDVVYNPDFDTLFQEETRPELEGYARGILTQSGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWNDSGEGKNDNQPLSSETWQALKHCVTTQLSGKRLFVV
DAFCGANPDTRLSVRFVMEVAWQAHFVKNMFIRPSDAELAQFTPDFVVMNAAQCTNPDWQ
AQGLHSENFVAFNLTERMQLIGGTWYGGEMKKGLFAIMNYLLPLKGIASMHCSANVGKSG
DVAVFFGLSGTGKTTLSTDPDRQLIGDDEHGWDDDGVFNFEGGCYAKTINLSAQAEPEIY
NAIRRDALLENVVVRRDGSVDYADASKTENTRVSYPIEHIENIVRPVSKAGHAKRVIFLT
ADAFGVLPPVSRLTPEQTQYHFLSGFTAKLAGTERGVTQPTPTFSACFGAAFLTLHPTQY
AEVLVKRMAAAGAQAYLVNTGWNGNGKRISLKDTRAIINAILAGELDEVETQTLPIFNLQ
MPTSLAQVNDAVLDPRASWSSATAWQAAAQDLAQRFINNFEKYTDNAAGAALVQAGPQLP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacggcctgacatcgcacgatctcgccactttgggcatcaatggcaccaca
gacgtggtgtacaaccctgacttcgacaccctgtttcaggaagaaacccgccccgaactg
gaaggttatgcacggggcatcctgacgcaaagcggggctatcgctgtcgatacgggtatc
ttcaccggacgttcgccaaaggataagtacatcgtgcgtgatgacaccacgcgcgacacg
ctgtggtggaacgacagtggcgaaggcaaaaacgacaaccaaccgctctccagcgaaacc
tggcaggcgctcaagcactgcgtcaccacacagctgtctggcaaacgcctgtttgtggtg
gatgcattctgtggtgccaatccggatacgcgcctcagcgtgcgttttgtgatggaagtg
gcgtggcaggcgcactttgtcaaaaacatgtttatccgcccgagtgacgccgaactggca
cagttcacaccggatttcgtggtgatgaacgccgcccaatgcaccaaccctgactggcaa
gcccaggggctgcattcagaaaatttcgtcgcctttaacctgactgaacgcatgcagctg
attggcggcacctggtatggcggcgagatgaaaaaaggtctgtttgccatcatgaactac
ctgctgccgctgaaaggcattgcgtcgatgcattgctcagccaacgtgggtaaaagcggt
gatgtggccgtgttctttggcctttccggcaccggaaaaaccacgctgtcgaccgatccg
gatcgtcagttgatcggcgacgatgaacacggctgggatgatgacggggtcttcaatttt
gaggggggttgctacgcaaaaaccatcaacctgtctgcccaggccgagccggaaatctac
aacgcgattcgccgtgatgccctgctggaaaacgtggtggttcgccgtgatggtagcgtc
gattatgccgacgccagcaaaacggaaaacacccgcgtctcttatcccatcgagcacatc
gaaaacatcgtgcgcccggtttccaaagcgggtcatgcaaagcgggtgattttcctcacc
gccgatgccttcggggtgctaccgccggtctcacgtttgacgccggaacagacgcaatat
catttcctctccggctttaccgccaagctggccggtacggaacgcggtgtaacccagccg
acaccgaccttctccgcctgctttggggccgcgtttctcaccctgcacccaacgcagtac
gccgaagtgctggtgaaacgcatggcagcggcgggcgcgcaggcgtatctggtgaatacg
ggctggaatggcaacggcaaacgtatttcgctgaaagacacgcgcgcgattatcaacgcg
attctggcgggtgagctggatgaggtggagacacagacgctgcccatctttaacctgcaa
atgcccaccagcctggcgcaggtgaatgacgcggtgctcgatccacgcgccagctggagc
agcgcgacagcatggcaggcagcggcacaggatttggcgcagcgttttatcaacaacttt
gagaaatacaccgacaacgcagccggggccgcattggtacaggccgggccgcaactgccg
taa

DBGET integrated database retrieval system