KEGG   Pantoea sp. At-9b: Pat9b_3755
Entry
Pat9b_3755        CDS       T01386                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pao  Pantoea sp. At-9b
Pathway
pao03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pat9b_3755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_3755
Secretion system [BR:pao02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pat9b_3755
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADU71045
UniProt: E6WH57
Position
4094887..4095369
AA seq 160 aa
MAIDIYLKVDGTTGESQDSNHKGWTDVLSFTWGASQPGNMSVGGGGGAGKVAYRDLNIKA
LIDKSTPAILKFCSSGKHVDKVEVSICKAGGNQVEYSKITLEDVLVTQTDFNGVGQSDTI
VVDYAFQASKVSMSYWEQGESGTKGAESKVSWDIKQNKES
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatttatttgaaagttgatggaacaacgggtgagtcccaggacagcaat
cacaaaggatggaccgatgtactctcctttacctggggggcttcacagccaggaaatatg
tcagtgggcggtggtggcggtgccggtaaagtggcttaccgcgacctcaatattaaggcg
ttaattgataaatccaccccggcgattttgaagttttgttccagcggtaaacatgtcgac
aaagtcgaagtgtcaatttgtaaagccggtggcaaccaggtggaatattcaaagatcact
cttgaagatgtgctggtaacacaaactgattttaacggcgtaggccagagcgacaccatc
gtcgtggattacgctttccaggcatccaaagtctcaatgagttactgggaacagggagaa
agtggcactaaaggtgccgaaagcaaagtgagctgggacattaagcagaataaagaaagc
taa

DBGET integrated database retrieval system