KEGG   Pantoea sp. At-9b: Pat9b_3927Help
Entry
Pat9b_3927        CDS       T01386                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00230  Purine metabolism
pao01100  Metabolic pathways
Module
pao_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pat9b_3927
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pat9b_3927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_16 AAA_18 AAA_33 AAA_22 ABC_tran AAA_29 MMR_HSR1 AAA_35 CPT
Motif
Other DBs
NCBI-ProteinID: ADU71217
UniProt: E6WBU7
Position
4283768..4284517
Genome map
AA seq 249 aa AA seqDB search
MRLGLTHKKEMRLTRRQTLRGGRKPCILCRKSTPLFTQFKKIMAQGTLYIVSAPSGAGKS
SLIQALLKTQPLYDTQVSVSHTTRGVRPGEAHGEHYFFVSKPEFEAMIAEDAFLEHAEVF
GNYYGTSRAAIERVLATGVDVFLDIDWQGAQQIRHKMPAARSIFVLPPSTEELDRRLRGR
GQDSEEVIARRMAQAVAEMSHYAEYDYLIVNDDFDLALSDLKTIIRAERLRMSRQKSRHD
ALISKLLAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggggctgactcacaaaaaagaaatgcgcctgacgcggcggcaaacgctgcgt
ggcgggcgtaagccgtgtatactgtgcaggaaatcgactccgctctttactcaattcaag
aaaatcatggctcaaggcacgctctatattgtttctgcccccagcggcgcaggtaaatcc
agtctgattcaggcgctgttgaagacacaaccgttatacgatacgcaagtgtctgtttcc
cataccactcgtggcgtgcgccctggtgaggctcatggtgaacattacttttttgtatcg
aaaccggaattcgaagccatgattgccgaggatgccttccttgagcatgcggaagtcttt
ggcaactattacggtacctcccgtgcggccattgaacgcgtactggcaaccggcgttgat
gtttttcttgatatcgactggcagggtgcgcagcaaatccgtcataaaatgcctgccgca
cgcagcatttttgtcttgccgccttcaacggaagagttagatcgccgtttgcgtggccgt
ggtcaggatagcgaagaggtcatcgcccgccgtatggctcaggccgtggcggaaatgagc
cactatgccgaatacgattacttaattgtgaatgatgatttcgatctggcgctgtccgat
ctgaaaaccatcattcgcgcagaacgtctgcgcatgagtcgccagaaatcgcgacatgat
gctttaatcagcaaactattggcagtctga

DBGET integrated database retrieval system