KEGG   Pantoea sp. At-9b: Pat9b_4096
Entry
Pat9b_4096        CDS       T01386                                 

Definition
(GenBank) conjugative transfer relaxase protein TraI
Organism
pao  Pantoea sp. At-9b
SSDB
Motif
Pfam: TrwC AAA_30 TraI_2B TraI AAA_19 ssDNA_TraI_N UvrD_C_2 DRTGG
Other DBs
NCBI-ProteinID: ADU73076
UniProt: E6WNU1
Position
pPAT9B05:86288..92104
AA seq 1938 aa
MMTIAPVASAADAAGYYSSKDNYYFLDDLQSQWLGEGARELGLEGPVDLDTFTAVLHGKL
PNGVEMGKDVQGSHVHRPGHDLTFSAPKSISMLILAGGDKRLLAAHHEAVKETLALVEQM
VSARDTRDGVTRITATGKMVAALFTHDTSRNLDPQIHTHAVLANVTELEGKWKALATDTI
HGAGFIETLYRYQVSFGKLYRTALKGKTEALGYETEFTGGKHELWEVKGFTDAVLEEFSS
RHREISARVGEEASLKSRDVAALDTRRPKQDISRLDDGQPVPQGEQPVTSPAGDNRTPDT
VPPERAVQPQTLSRSDAPEQGEPDAPDGRAVARTAEQENTLPEAPGAEQEAPQPGERPPG
RDSMNEQAGPDQEPPIEKPETPDGRARLHERWQRQMDSVDFDIGGVMRDAREREAARTEP
GEEPPLPGEVMDAVRTAISVLSDSRTRFTYGDLLLTAHQAGEQQHSIPELRRALDQAISD
NLLAPLDGDKGVFTSHIHLLDELSVQSLAADIIKENRVANFRESPGMTPEHLKQAQRAPV
AILNAPASVQRLRDTVEELVTMSRENGREVSVLASGAERALTLGKSALLKDTLLQRSRVT
EKTFSLAPQSTLIIEGAEKLGLKEMLVLTGEAREKNAQLLFLDSAGRQSNTNALSVLASA
GVERLSLTAPGPGLEARVFSIQDKRDRYRALAERFTDLSGPDNTVTAAVTGAREQQQLTG
YIRDALQNAGKLGRDTVQVEARTPVFITAKERKLPVSYRPGMVLEDRSDRQEIRHYMIDR
VHDDTRMLSLIDGDGVLSRVKLSTLTADWRLFTREQLSIAQGEQLFALAADRSAGLKARD
RLTVTALENGALTVMREGQQKPLRIATDRPLYVTHGYVSAPGARDNERGTVLASLSSREL
SVNMMNALAQSGTEAEIFTGEALNRAEEKMMRLRTGRSPVALVRQASGREDVSDALETLN
ANLLSDAEKAVSRAVAQMRHVSFSEVKLLEGAEDFLENVPALRTEIARQVKAGDLMPVKV
SGEPRFVSRATWEMEKAIIGEIAAGKNAVEPLMATIAPSLLTGLTAGQQAATTLILQSPD
RFTAVQGYAGTGKTTQFKAVKAAIETLPESGRPLIIGLAPTHRAVKEMRDTGIEAQTLKS
FVLDWQQRTAAGEEVRYGNTLFLIDESSMLGNQDTAAAYRAIAAGDGRAVPVGDVAQLES
PESGAPFRLMQERSPIDVAVMKEIVRQRDANLKSAVYSVIENKAAAALEKINRVSPGTVP
REAGEVVPLRSVTETGSPVSNIVADYIGRTKAAREQTMIVVQLHEDRRAINEGIHASMVQ
RKELGEKAVTVPVLDRITGGRHDFNRIGDWKAGQVVLANERYLTVTGADRGTGHVLLRDE
SGRMQYWSPAELNATEIEVFERREIELREGDSVRLNKTQKQAGHAAHEQYRVAELRENGE
IVLKNRDGEKVIDPKAVTADRHVDYAWAVTGYGAQGASTDYVIALEGTEGARANMSGMRA
FYISASRAKDHVQIYTDGLKDWLETLQGGKNGPATAHDALSPEPERAQARAIWAMGQPLS
KTALGRAFLRGQGLKGAPLTARIIPPTKKYPDAHLALPVYDGNGKTAGLTLVPLTAEAGQ
PEPGEVRQLITGGAQAAIVQKSRDGEMIIVSDLQQALAAARNKPQAGVLLLTGRHPPSAQ
LLKVAGGQPGRGWRPDATLLRLVQAELREGLRDLPPDAPVPDERAALRAALDALEKGQET
GQNVPSAPGRDSAQENSRDVRAIAQQLTEGAMASPGTVPVVTERDRAQLSALLAMRVVEA
MKQQLPSLPGEPVPDYAALVRQASAALAAEAGGPDSAAVRAVLDILSGVSLPQEPGISAT
TGQGDSIPAGVLKQVREEIARERVPPGAPQQQALSESTLAGVARELERRPELPSDIRGRE
PEREELTRESVRHIQKER
NT seq 5817 nt   +upstreamnt  +downstreamnt
atgatgaccattgcaccggtggcgtccgccgcggacgcggccggttactacagcagcaag
gataactactatttcctggacgatctgcagagccagtggctgggcgaaggggcccgtgaa
ctgggtctggaaggcccggtggacctggacacctttaccgccgtactgcacggaaaattg
cccaacggggtggaaatgggtaaggacgtgcagggcagtcacgttcaccgccccgggcat
gacctgacgttttcggccccgaaaagcatctccatgctcattctggccgggggggataaa
cgtctgctggccgcccaccatgaggcggtaaaggaaacgctggcgctggttgagcagatg
gtaagcgcccgtgacacccgggacggggtgacccgcatcacggcgaccgggaaaatggtg
gccgccctgttcacgcacgacacctcacgtaatcttgacccgcagatccacacccatgcg
gtgctggccaacgtgacagagctggaggggaagtggaaggcgctggccacggacaccatt
cacggggccgggtttatcgaaaccctttaccgctatcaggtgtcattcggaaagctgtac
cgcaccgcgctgaaagggaaaaccgaggcgctggggtatgagacggaattcaccggcgga
aagcatgagctgtgggaggtgaaaggtttcaccgacgccgtactggaggagttttcctcc
cggcaccgcgaaatcagcgcgcgcgtgggtgaggaagcgtcgctgaaaagccgcgacgtg
gcggcgcttgacacccggcggcccaaacaggatatcagccggctggatgacggccagccg
gtcccacagggtgagcagcccgtgacttcgccggcaggagataacaggaccccggatacc
gtgccgcccgaacgggctgttcagccgcagacgctcagccgttccgatgcacctgagcag
ggcgagccagacgcgcctgacggtcgcgcggttgcccgcactgctgagcaggagaacacg
ctgccagaggcaccgggcgcggagcaggaagcccctcagccgggagaacgtccgcccggc
cgcgacagcatgaatgaacaggccgggcctgaccaggaacctcccatcgaaaaaccggaa
accccggacggcagagcccgcctgcacgaacgctggcagcgtcagatggacagcgtggat
tttgacattgggggagtgatgcgtgatgcccgtgaacgcgaggcggcacggacggagccc
ggagaggaaccacccctgccgggtgaagtgatggacgccgtgcgcaccgccatttcggta
ctgagcgacagccggacgcgctttacttacggcgacctgctgctgacggcccaccaggcc
ggtgagcagcagcacagcatcccggagctgcgccgcgcgctggaccaggccatcagtgac
aacctgctggccccgctggacggggataaaggcgtgttcacctcccacattcacctgctg
gatgagctgtccgtgcagtcactggcggccgatatcataaaggagaatcgcgtggcgaac
tttcgtgaatcccccggcatgacgccggaacatctgaaacaggcgcagcgagcaccggtg
gccatcctgaacgccccggcgtcggtacagcgcctgcgcgatacggtggaggaactggtg
acaatgtcacgggaaaacggccgggaagtcagcgtcctggcctcgggtgccgaacgcgcc
ctgaccctcggcaaatcggcgctgctgaaagataccctgctgcagcgcagccgcgtcacg
gagaaaaccttcagcctggcgccccagagcacgctgattattgagggggcggagaagctg
gggctgaaggagatgctggtcctgaccggcgaggcgcgggagaagaacgcccagctgctg
tttctcgacagcgccggccgccagtcgaacacgaatgccctgtcggtgctggcctcggcc
ggcgttgaacgcctcagcctgacggcccccggaccggggctggaggcgcgcgttttcagc
attcaggacaaacgtgaccgctaccgtgctctggcagagcgctttaccgacctgagcggc
ccggacaatacggtcacggcggccgtgaccggcgcgcgtgaacagcagcaactgacgggg
tacatccgcgatgcgctgcagaatgccgggaagctcggccgtgacaccgtgcaggtggag
gcgcgcacgccggtcttcatcacggcgaaagagcggaagctgccggtatcgtaccggccc
ggcatggtgctggaggaccgcagcgaccggcaggaaatccgccactacatgattgaccgg
gtacatgacgacacccgaatgctgtcgcttatcgacggtgacggcgtgctgagccgggta
aaactcagcaccctcaccgccgactggcgtctgttcacccgggaacagctgagtatcgcg
cagggtgagcagctgttcgcgctggccgcagaccggtctgccgggctgaaggcgcgcgac
cgtctgaccgtcacggcgctggagaacggggcgctgacggtgatgcgggaggggcagcag
aagccgctgcgcatcgccacggaccgccccctgtacgtcacccacgggtacgtcagcgcg
ccgggcgcgcgggataacgaacggggcacggtgctggcgagcctgagcagccgggagctg
tcagtcaacatgatgaacgccttggcgcagtccggcactgaggccgaaatctttaccgga
gaggcactgaaccgggcggaggagaagatgatgcggctgcgcaccggccgttccccggtg
gcgctggtcagacaggccagcggccgggaggacgtcagcgacgcgctggagacgctgaat
gcgaacctgctgtcggatgcggagaaggccgtatcccgcgccgtggcgcagatgcgccat
gtgtccttttccgaggtgaaacttctggagggagcggaggactttctggagaacgtgccg
gcgctccggaccgaaattgcccgacaggtgaaagccggtgacctgatgccggtgaaggtc
agcggcgagccgcgctttgtctcccgcgcaacgtgggaaatggaaaaggcgattatcggg
gagattgcggccggcaagaacgcggtcgagccgctgatggccaccattgccccgtccctt
ctcaccggactcaccgccgggcaacaggcggccaccacgctcattctgcagagtcccgac
cgctttacggcggtacaggggtacgccgggacgggtaaaaccacgcagtttaaggcggtg
aaggcggccattgagaccctgccggagagcgggcgtccgctgattatcgggctggctccc
acacaccgtgcggtcaaagagatgcgcgataccggcatagaggcgcagacgctgaagtcg
ttcgtgctggactggcagcagcgtaccgccgccggtgaagaggtccgctacggcaatacc
ctgtttctcatcgatgagtcctcgatgctgggcaaccaggacaccgctgcagcgtaccgc
gcgattgcggccggtgacgggcgcgccgtgccggtcggggacgtggcgcagctggagtcc
ccggagagcggtgccccgttccggctgatgcaggagcgcagccccatcgatgtcgccgtg
atgaaagagattgtgcgccagcgcgacgcaaacctgaaatccgccgtctacagcgtgatt
gaaaacaaggcggccgccgcgctggagaaaatcaaccgggtgtcgccggggacggtgccg
cgggaagccggtgaggtggtcccgttacgctcggtgacggagacgggctccccggtcagc
aacatcgtggcggattatatcggccgcacaaaagcagcccgggagcagacgatgatcgtg
gtgcagctgcatgaggaccgtcgcgccatcaatgagggtatccacgccagcatggtgcag
cgaaaagagctgggcgaaaaagccgtcacggtgccggtactggaccgcatcaccggcggc
cgccacgactttaaccgtatcggggactggaaggccgggcaggtggtgctggcaaacgaa
cgctacctgaccgtgaccggcgctgaccggggaaccgggcatgtgctgctgcgggatgaa
agcgggcggatgcagtactggtcgccggcggagcttaacgccaccgaaatcgaggtgttt
gagcggcgtgaaatcgagctgagggaaggcgacagcgtgcgcctgaacaaaacgcagaaa
caggcaggtcatgccgcgcacgagcagtaccgcgtggcggaactgcgggagaacggtgag
atcgtactgaagaacagggacggtgaaaaggtcattgacccgaaggccgtcacggcagac
cggcatgtggactatgcctgggcggtgaccggttacggcgcacagggggcaagtaccgac
tacgtgatcgcgctggagggaacggaaggggcccgcgcgaacatgagcggaatgcgggcc
ttttacatcagcgcctcgcgcgcgaaggaccatgtgcagatttacactgacggcctgaaa
gactggctggagaccctgcagggtgggaagaacggtccggcaacggcgcatgatgccctg
tcaccggagcctgagcgggctcaggcccgggccatctgggcgatggggcaacctctgtcg
aaaacggcgctcggtcgcgccttcctgcgcgggcaggggctgaagggggcaccgctcacc
gcccggattatcccgccgacaaaaaaatacccggacgcgcatctggcgctgccggtgtat
gacggcaacggcaagacggcggggctgacgctggttccgctgacagcggaagccggccag
cctgagccgggtgaggtgcgtcagcttatcaccggtggtgcacaggctgccatcgtgcag
aaaagccgggacggagagatgatcatcgtcagtgacctccagcaggcgctggcggccgca
cggaataagccacaggcgggcgtgctgctgctgaccgggcgtcatccgccgtcggcccag
ttactgaaagtggccggtggccagcccgggcggggctggcgtcccgatgccacactgctg
cgtctggtacaggctgagctccgggaggggctgcgcgacctgccgccggatgcaccggta
cccgatgagcgtgccgcactgcgtgcagccctggacgcactggaaaaaggccaggaaacc
ggtcagaacgttccgtccgcgccaggacgggacagtgctcaggagaacagccgtgacgtg
cgtgccattgcacagcagctgacagagggtgcgatggccagcccgggcaccgtcccggtg
gtgacggaacgggacagggcacagctgtctgcgctgctggccatgcgggtggtggaggcg
atgaagcagcaactgccgtccctgcccggcgaacccgtaccggactatgccgctctggtc
agacaggcctcagctgcactggcggccgaagccggtggcccggacagtgcggctgtccgg
gccgttctggacatcctgtccggcgtctcgctgccgcaggagccgggaatttctgccact
accggccagggtgacagcataccggcaggggtactgaagcaggtccgggaggagattgca
cgcgagcgggtaccgcccggggcaccacaacagcaggcgctgtcagaaagtacactggcc
ggcgtggcccgtgagcttgaacggcggccggagctgccgtcagacatacggggccgggaa
ccggaacgtgaagagctgacacgcgagagcgtccggcatatccagaaagaacgctga

DBGET integrated database retrieval system