KEGG   Pantoea sp. At-9b: Pat9b_4128Help
Entry
Pat9b_4128        CDS       T01386                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1471 YbgS
Motif
Other DBs
NCBI-ProteinID: ADU72692
UniProt: E6WMQ7
Position
pPAT9B04:complement(1235..1444)
Genome map
AA seq 69 aa AA seqDB search
MKSIKTFVVVAALSLVSFASFAQSITASASTLDGAEAKIAAQAKQAGASYKITGARVDNG
AYLSAELTK
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctatcaaaactttcgttgtagttgcggccctgtcactggtttcgttcgctagc
tttgcacaaagcatcacggcttcggcctcaacgctggacggcgcagaagcgaaaatcgcg
gctcaggcaaaacaggcgggtgcatcatataaaatcaccggtgcacgcgtggataacggt
gcttacctgtcagcggaactgaccaaataa

DBGET integrated database retrieval system