KEGG   Pantoea sp. At-9b: Pat9b_4131Help
Entry
Pat9b_4131        CDS       T01386                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_30 Gp37
Motif
Other DBs
NCBI-ProteinID: ADU72695
UniProt: E6WMR0
Position
pPAT9B04:4340..5239
Genome map
AA seq 299 aa AA seqDB search
MKTDIRNLDLNLLKALDALLDERSVTRAAERLSLTQPAVSGMLTRLRECFDDPLFTRAQR
GIIPTLRALELAAPVKTILAEVGELLKPREFDPATAEMTINIAATDYALRAVVVPFMAAL
RQQAPGIRVAVLPVNNDLLPMQFERGAVDVALITPETTPPELHAKTLYAEDYVCLLRADH
PLAPSGVLSLDEFCSQDHALVSYVGGSFHGVTDEALATLGRSRRVTLSVCSFLVLPEILR
VSDLISVVPRRLALNTTGLKIVAPPLAIPGFTKSVAWHERTHRDPGHRWLRDLLFSTAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgatatcaggaatctggatctcaacctgctgaaagcgctggacgcgctgctg
gatgagcgtagcgtcacgcgtgccgctgaacggttatcactgacgcaacccgcggtcagc
ggtatgctcacccggttacgtgaatgttttgacgacccgttattcacgcgcgcgcagcgc
ggcattatccctaccttacgggcgctggagctggctgcgccggtaaaaactatccttgcg
gaagtcggggagctgttgaagccgcgtgaattcgatccggccacggctgaaatgaccatc
aatatcgccgcgacagattatgcgttacgtgcggtggtcgtgccgtttatggccgcctta
cgtcagcaggcaccgggtatccgcgtggcggtgttaccggtgaataacgacctgttgccg
atgcagtttgaacgtggtgcggtcgatgtcgcattgatcaccccggaaaccactccgccc
gaattgcacgcaaaaacgctgtacgcggaagattacgtttgcctgctgcgtgccgatcat
cctttggcaccctccggcgtcttgtctttagatgaattctgctcacaggatcatgcattg
gtgtcctatgttggtggcagttttcacggcgtcaccgatgaagcactggcgaccctgggc
cgctcccgccgggtgacactgtccgtgtgcagtttcctggtactgccggaaatcctgcgg
gtgagtgatttgattagcgtggtgccacgcaggctggcattgaataccaccggattaaaa
atcgtggcacccccgttggctattccaggtttcaccaagtcggtcgcctggcatgaacgc
acccaccgcgatccgggacatcgctggttgcgagatttgttattttccaccgcgttatga

DBGET integrated database retrieval system