KEGG   Pantoea sp. At-9b: Pat9b_4136Help
Entry
Pat9b_4136        CDS       T01386                                 

Definition
(GenBank) entry exclusion protein 2
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADU72700
UniProt: E6WMR5
Position
pPAT9B04:complement(8904..9320)
Genome map
AA seq 138 aa AA seqDB search
MNGNVGILSIAALSLLLLSGCAQTDSSAKRHAIKFVYTVEDSDPNFMMNRADSIRMATPF
FEQFWQLGKKDRTQGISSADAQKRVSYFHSDEFIKSISGTSRFAGKEYKDNASLSPRWRN
NMSEAVAQTYMDGYLGKE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaatgtaggtattttgagtatcgctgctttatccctcctgttactgagtggt
tgtgcacagacagattccagtgcgaaacgccacgcgattaagtttgtctatacggttgaa
gattctgatcctaatttcatgatgaacagagcggattcgatccgcatggcgacgcctttt
tttgaacagttctggcaactgggcaaaaaagaccgcacgcaaggcatctccagcgctgat
gcgcagaaaagagtcagctatttccatagcgatgagttcataaaatccatcagtggaaca
tcacgatttgcgggcaaagagtacaaagacaatgccagtttatcaccacgctggcgtaac
aatatgtcggaggctgtcgcacaaacctatatggatggatatctcggcaaggagtaa

DBGET integrated database retrieval system