KEGG   Pantoea sp. At-9b: Pat9b_4141Help
Entry
Pat9b_4141        CDS       T01386                                 

Definition
(GenBank) Methionine synthase vitamin-B12 independent protein
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00270  Cysteine and methionine metabolism
pao00450  Selenocompound metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01230  Biosynthesis of amino acids
Module
pao_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pat9b_4141
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pat9b_4141
Enzymes [BR:pao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     Pat9b_4141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 CNP1 Meth_synt_1 URO-D DUF667
Motif
Other DBs
NCBI-ProteinID: ADU72705
UniProt: E6WMS0
Position
pPAT9B04:complement(14051..15079)
Genome map
AA seq 342 aa AA seqDB search
MKKLLPTSTAGSLPKPSWLAQPETLWSPWKLQGTELIEGKQDALRLCLEDQLRAGIDIVS
DGEQTRQHFVTTFIEHLSGVDFEKREIVKIRNRYEASVPSVVGEVARQKPVFVEDAKFLR
QLTSQPIKWALPGPMTMIDTLYDGHYKSREKLAWEFAKILNQEAKELEAAGVDIIQFDEP
AFNVFFDEVNDWGIAALERAIEGLKCETAVHICYGYGIKANTDWKKTLGTEWRQYEEVFP
KLQKSNIDIISLECHNSHVPMDLIELIRGKKVMVGAIDVATNTIETPEEVANTLRNVLRF
VDADKLYPSTNCGMTPLSRRVATGKLNALSAGAEIVRKELLG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattattacctacttcaactgctggcagtttacctaagccctcctggcttgca
caaccggagacactttggtcgccctggaaattgcagggtacggaattaattgagggtaaa
caagatgcgctgcgtctgtgcctggaagatcaattaagggcgggtatcgatattgtcagc
gatggtgagcaaacccgccaacattttgtcacgacatttattgaacatctcagcggcgtt
gattttgagaaacgcgagatcgttaaaattcgtaatcgctatgaagcgagtgtcccctct
gtcgtgggtgaggttgctcgtcaaaagcccgtttttgttgaagatgcaaaatttttacgt
caactgaccagccaaccgattaaatgggccttgcccggtcccatgacgatgattgatacc
ctgtacgatggtcattataaaagccgggaaaaacttgcctgggaatttgccaaaattctt
aatcaggaagccaaagagttagaggcggcaggtgtagatattatccagtttgatgagcca
gcgtttaatgtgttttttgacgaggtgaatgattggggaattgccgccttagaaagagcc
attgaagggcttaaatgtgagacggctgtgcatatttgctacggctatggcatcaaagcg
aataccgactggaaaaaaacgctggggactgagtggcggcaatatgaagaggtgttcccc
aaactgcaaaaatccaacatcgatatcatctcgctggagtgtcacaactcacatgttcca
atggatctgatcgaactgattcgtggtaaaaaagtgatggtgggggctatcgacgtggca
accaacaccattgaaacgccagaggaagttgccaatacgctgcgcaacgtgctgcggttt
gttgatgccgataaactttatccttctaccaactgcggcatgacgccattatcgcgtcgg
gtagccacaggtaaactcaatgcgttaagtgcgggcgcggaaatcgttcgcaaagaactc
ctgggctga

DBGET integrated database retrieval system