KEGG   Pantoea sp. At-9b: Pat9b_4143Help
Entry
Pat9b_4143        CDS       T01386                                 

Definition
(GenBank) PfkB domain protein
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00051  Fructose and mannose metabolism
pao00500  Starch and sucrose metabolism
pao00520  Amino sugar and nucleotide sugar metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pat9b_4143
   00500 Starch and sucrose metabolism
    Pat9b_4143
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_4143
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     Pat9b_4143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB DUF4689
Motif
Other DBs
NCBI-ProteinID: ADU72707
UniProt: E6WMS2
Position
pPAT9B04:16464..17390
Genome map
AA seq 308 aa AA seqDB search
MSARVWCLGDAVVDLLPEADGRLLQCPGGAPANVAVGIARLQGNSGFIGRVGDDPFGHFM
RQTLAGEQVDIRFMTADPVHRTSTVVVSLDADGERSFTFMVRPGADLFIEPADLPPFQSD
EWLHCCSIALAAEPSRSTTFTAMERIKAAGGRVSFDPNIRHDLWSDPAQLMTCLNQALQM
ADVVKLSEEELAFIAGSGQTDTAMHQLAAEFGLVLLLVTQGKAGVLAWHNNRITHYPTLP
VISVDTTGAGDAFVAGLLWGLARHGLPQDEPQLATRLARAQICGALATTAKGAMTALPWL
QQLEQQLA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacgtgtctggtgtctgggagacgccgtagtggatctgttgccggaagcagat
ggacgattgttgcaatgtccgggtggcgcaccggcaaatgttgctgtcggtatcgcgcga
ttgcagggtaacagcggttttattggccgtgtcggtgatgacccttttggtcattttatg
cgccaaacgctggcgggcgagcaggtggatatccgctttatgactgccgacccggtgcat
cggacctcgaccgtggtggtttcgctggatgcagacggtgaacgttcgtttacttttatg
gtacgcccgggagccgacctttttatcgaaccggctgatttgccgccatttcaatccgat
gagtggctgcactgctgttcaatagcgctggccgcagagccctcccgttccaccaccttt
accgccatggagcgcataaaggccgctggaggtcgggtcagtttcgacccgaatatccgc
cacgacctgtggtcagacccggcccaactgatgacatgccttaaccaggccttgcagatg
gcagatgtggtgaagttgtcagaggaggaactggcgtttattgccggatcgggccagacc
gataccgccatgcaccaattggccgcagaatttggtcttgtattgctgctggtgacgcaa
ggcaaagctggcgtactggcctggcataataaccggatcactcactaccccaccctgccg
gtaatcagcgtggacaccaccggggctggcgatgcctttgttgcaggcttgctgtgggga
cttgcccgacatggactaccgcaagatgaaccccagctggcaacacgtcttgcccgggcc
cagatttgtggcgcactggcaaccaccgccaaaggagccatgacagcactgccgtggctg
caacagcttgagcagcaactcgcctaa

DBGET integrated database retrieval system