KEGG   Pantoea sp. At-9b: Pat9b_4170Help
Entry
Pat9b_4170        CDS       T01386                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
pao  Pantoea sp. At-9b
Module
pao_M00236  Putative polar amino acid transport system
Brite
Transporters [BR:pao02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Pat9b_4170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ADU72734
UniProt: E6WMU9
Position
pPAT9B04:43290..44114
Genome map
AA seq 274 aa AA seqDB search
MTFKLHHFVLPLLMAAAPLFSHAEESTWDHIKQTGELRIGVAQGEPWYFKDPSTGEWNGI
GYNVGKVLAKDLGVKLVPVETTWGNAVAAIQAGQIDTMLVLDPTDERRKAADFSDQPFLW
YAQGVLIRDGIPATNWEDLNRPDIKIGVTLGSSPDLILTKKLPKAQLVRFTNMDEGVAAF
YAGRVDALSYVHPALALQQAKVHKGNLILPKPIIAISTGGALRKESDPRFRNFLNEEFVK
IYKSGQSKQFYEDALKLRGVDISKVPSVIKEEWQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacattcaaactgcatcacttcgtactgcctttacttatggcggccgctccccttttc
agccatgcggaagaatccacctgggaccatatcaagcaaaccggtgagctgcgtatcggt
gtcgcccagggggaaccctggtattttaaagatccttcgaccggcgagtggaacggcata
ggctataacgtgggtaaagtgctggcgaaagatcttggggtaaaactggtgccggttgag
accacctggggtaacgccgtggcggcaatacaggcagggcaaattgataccatgctggtg
ctcgatcccactgatgaacggcgtaaagcggctgatttctccgatcaaccgtttctctgg
tacgctcagggggtgttgatccgcgatggcattcccgcgacaaactgggaagatctcaac
cgtcctgacatcaaaattggtgtaacgctgggcagcagcccagacctcattctgaccaaa
aagctcccaaaagcacagttggtgcgtttcaccaatatggatgaaggtgtcgccgctttc
tacgccggacgcgttgatgcgctctcctatgtccatccggcattggcattacagcaggcc
aaagtgcataagggcaatctgatcctgccgaaacccattattgccatcagcaccggtggc
gcattacggaaagagagcgacccgcgtttccgcaatttcctgaatgaggaattcgttaaa
atctacaaatccggtcagagcaagcagttttacgaggacgcactgaaattacgtggtgtg
gatatcagtaaagtcccttccgtcattaaagaagagtggcaataa

DBGET integrated database retrieval system