KEGG   Pantoea sp. At-9b: Pat9b_4171Help
Entry
Pat9b_4171        CDS       T01386                                 

Definition
(GenBank) MmgE/PrpD family protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: ADU72735
UniProt: E6WMV0
Position
pPAT9B04:complement(44116..45510)
Genome map
AA seq 464 aa AA seqDB search
MVHSNSLTCQLTTFACQLTPDAIPTALKRKILLHFIDSLGCGVAAREDRVLQMSARMARS
QYAAGNSITLDGGTPLASTGAAFLNAVAINALDYDDGFEVAGRGMGHPGATLVAGALAAI
GSRQVSGAAFVTALVAAWEINGRVILSQQPSPERFRQVYGVCQHESLGAAVAYGLLNGCD
ARELENCLGLAASLTPLPSLHKYNWQQRPLVSLKDYNAPAAEAGVRAVEMHLAGIIGPHD
VLAGEQGFWRMMGSDQFHPDVLIDNLGSVWQLQHASIKTYPTCRWMHTALQSFEEVLITL
PDPEKIQRVRVYASQLLANLFTDTRPQCSTDAQFSLPLAIACLVFRVPRHLWSSDAVRTS
DDILHFAERVEVLAETHFDQLMQRHRRPAARVEVVMQDTVLMGKTIDYPAGTQENPLSEQ
QIVDKFIANLSALMLPEHARIFAQQLLDMERCEDIGAMLAPILG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggttcactccaattctctgacctgccaattaacaacattcgcctgccagctgactcct
gatgcaatccctacggcgctgaaacgaaaaattctgctgcattttatcgatagcctggga
tgtggcgtggctgcccgggaagatcgcgtgttacagatgagtgccaggatggcgcgttca
cagtatgcagcgggtaacagcatcacgctggatggtggcacaccgctcgcctctacaggt
gccgcctttcttaatgctgtcgctatcaatgcgttggattacgatgacggctttgaagtg
gcggggaggggaatggggcatccgggagcaacattggtggcgggcgcgttggcggcaatc
ggttcccgccaggtcagtggtgcggcctttgttactgctctggtggcagcctgggagatc
aatggtcgggtgattctttcacaacaacccagtccggaacgttttcgccaggtatacggt
gtctgccagcatgaatcattgggggctgcggtggcatacggtctgctgaacggctgtgat
gcgagggaactggaaaattgtctcgggctggcagcgtcactgacgccattgccgtcattg
cacaaatacaactggcagcagcgaccgctggtctccctgaaagactataacgcgcctgcc
gctgaagcaggggtgcgtgcggttgaaatgcatctggcaggtatcatcggtccgcacgat
gtcctggcaggggagcagggattctggcggatgatggggtcagatcagttccatcctgac
gtgttaatcgataatcttgggtcggtctggcagctacaacatgccagcattaaaacgtat
ccgacctgccgctggatgcataccgcactgcaatcgttcgaggaggtgttgattacactc
cccgacccggaaaaaatccagcgtgtgcgagtttatgccagtcagctgctggcaaacttg
tttaccgatacccggccacagtgtagtaccgatgcgcaattcagcttgccgttggctatc
gcctgcctggtcttccgggtacctcgccatctgtggagcagcgatgcagtgcgaacttcc
gacgatattctccattttgcggagcgagtggaggtactggcggaaacgcattttgatcaa
ctgatgcagcgacaccgtcgcccggcggcgcgcgtagaggtggtgatgcaggatacggtg
ctgatgggtaaaactattgattacccggcaggcacgcaagaaaacccactgtcagaacag
cagattgtggataagttcatcgcaaacctgtcagcgctgatgctgccagagcatgcacgg
atatttgctcagcagttgctcgatatggaacgctgcgaggatatcggggccatgcttgcc
ccgatactgggttag

DBGET integrated database retrieval system