KEGG   Pantoea sp. At-9b: Pat9b_4178Help
Entry
Pat9b_4178        CDS       T01386                                 

Definition
(GenBank) initiator RepB protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rep_3
Motif
Other DBs
NCBI-ProteinID: ADU72742
UniProt: E6WMV7
Position
pPAT9B04:50407..51426
Genome map
AA seq 339 aa AA seqDB search
MAKKVNDLDSMTEEVNKKTGEVVHLNPSAAATVQPVALMRLGLFVPNTDHAKAKSSVNTV
KSTVDATEDLYHLEVVKREGYKDISIRSERLDMATDFRVWLGIIRSIYDNGTFAGKLKLP
FTKFLQNCGFDSKRSNKDMKKRIDDSLMRLRGVTIQFRNDTGSLTTGLVNSAHYNMAKNE
VEIEGDHRLADLYQMDYKVYLRLKAIDHLPRKESAQALYTFIESLPRNPAPVSMKRLRER
LRLKSRIAYQNHIVRKALEELKEINYLEYTETKRGRSVYFNITKRNPNLIPDKSLKLDRS
AEDEPQIVDEAMIAKISKLKDSGFSEEEIAKILISLDSK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaagtcaatgacttagatagcatgaccgaggaagttaataagaaaacgggc
gaagttgtccacttaaatccttcggcagcagcaacggtgcagcctgtagcattgatgcgg
ctgggtcttttcgttcccaataccgatcatgcgaaagcgaaaagctcagtcaacacggtt
aagtctacagtggatgcgactgaggatctttaccatttggaagtggtgaaaagggaaggg
tataaagatatctcgatccgctcagaacgccttgatatggcaactgattttcgtgtctgg
ttggggatcattcgttcgatctatgataacggtacctttgccggtaagttaaaattgccg
tttactaagtttttgcagaactgcgggtttgactcaaaacgttcgaacaaagacatgaag
aagcgtatcgatgactcactgatgcgcctgcgtggtgtgactatccagttccgtaatgac
accggttctttgacgacgggtttggtgaacagcgcgcattacaacatggcaaaaaatgaa
gtcgaaattgagggcgaccatcggctggcggatctctatcagatggattacaaggtgtac
ctgcgcctcaaagccatcgaccatttgccccgtaaagagtctgcacaggccctctatacg
tttatcgagagtctcccccgcaatccggcaccggtctcgatgaaacgtctcagagagcgt
ctgaggctcaaatcgcgtatcgcttaccaaaaccacattgtgcgtaaggcgctggaagag
ctaaaggaaatcaattatctcgaatacaccgaaaccaagcggggtcgatcggtctatttc
aacatcactaagcgtaatccaaacctgatcccggataagtcgttgaaactcgacaggagt
gctgaggatgaacctcagatcgttgatgaggcgatgatcgctaaaatcagtaaactcaaa
gattctggcttcagtgaggaagagattgccaagatcctgattagcctcgattcaaaatga

DBGET integrated database retrieval system