KEGG   Pantoea sp. At-9b: Pat9b_4179Help
Entry
Pat9b_4179        CDS       T01386                                 

Definition
(GenBank) partitioning protein A
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA VirC1 MipZ Fer4_NifH
Motif
Other DBs
NCBI-ProteinID: ADU72743
UniProt: E6WMV8
Position
pPAT9B04:52791..53999
Genome map
AA seq 402 aa AA seqDB search
MKSNYGGVDETARRANAMLRSMSDDIIDKRHEFGLDRYYQTFTRNSVANMPKLSRRAVEQ
AIDEMEAAGHEFGKKDAGNARHYALTVQDVVDIYAHRKVPKYRDIHAGKGPFVIFVVNLK
GGVSKTVSTVTLAHGLRVHPDLLQYDLRNLVIDLDPQASSTMFLNHTNSIGSIMETAAQA
MLNDLDAEQLHKDIIQPTIIPGVDIIPASIDDGFVASQWNELVHEHLPGLLPSEVLRRNI
IDRVGDDYDFIFVDTGPHLDAFMLNAIAASDLLLTPTPPAQVDFHSTLKYLTRLPEMLEQ
LEEEGINPRIKGNIGFMSKMTTKRDHEMTHGLARDVFTSYILDATLPRLDGFERCGETFD
TIVSADPQSYPGSAEALKNAKREAERFTQAVFKRIEFVRGIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtaactatggtggcgtggacgagactgcccgcagggctaacgcaatgctgcgc
agtatgagtgacgacatcatcgataagcgtcatgaatttggacttgaccgttactatcag
acctttacccgaaactctgtggccaatatgcccaagctcagccgccgtgctgttgaacag
gcaatcgacgaaatggaagcggcgggtcacgagtttggcaagaaagatgccggtaatgcc
aggcattacgcgctcaccgtgcaagatgttgttgatatttatgcacaccgtaaggtgcct
aagtatcgcgacattcatgcaggcaagggaccgttcgttatctttgtggtgaacctgaag
ggcggtgtatctaaaacggtcagcacggtaacgcttgcccatgggcttcgtgtgcatcct
gacctgttgcagtatgacctgcgtaaccttgtgatcgatctcgacccacaagcctccagc
acgatgtttctgaaccataccaacagtatcggttccattatggagacagcggctcaggcg
atgttgaacgatttggatgccgagcagctacataaggacatcatccagccaaccatcatt
cctggtgtcgatatcatcccggcttctatcgacgatggctttgtcgccagccagtggaat
gagttagttcacgagcatttgcctggtttgttaccttctgaagtgctgcgccgcaatatc
attgaccgtgttggcgatgattacgatttcatcttcgttgataccgggccgcacctggat
gcctttatgttgaatgcgattgcggcgagtgatttgctactcacccccacgcctcccgcg
caggttgattttcactcgaccttaaaatacctgacgcgtctgccagaaatgctggagcaa
ctggaagaggagggcattaacccgcgcatcaagggcaacatcggattcatgtcaaaaatg
accaccaaacgtgatcatgagatgacacatggtctggcgcgcgacgtattcacatcctac
atcctcgatgccactttgccacgccttgatggattcgagcgttgtggtgaaaccttcgac
acgatagtaagtgctgacccacaatcctatccgggcagcgcggaagcgcttaaaaatgcc
aagcgtgaagcggagcgatttacacaggcggtattcaaaaggatcgaatttgtgaggggt
atcaaatga

DBGET integrated database retrieval system