KEGG   Pantoea sp. At-9b: Pat9b_4185Help
Entry
Pat9b_4185        CDS       T01386                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K01502  aliphatic nitrilase [EC:3.5.5.7]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00643  Styrene degradation
pao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    Pat9b_4185
Enzymes [BR:pao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.5  In nitriles
    3.5.5.7  aliphatic nitrilase
     Pat9b_4185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Glu_syn_central
Motif
Other DBs
NCBI-ProteinID: ADU72749
UniProt: E6WMW4
Position
pPAT9B04:58178..59179
Genome map
AA seq 333 aa AA seqDB search
MAGSRIIRAAAAQIAPDLHEASKTLARVLEAIDQAAEQGAEIIVFPETFVPYYPYFSFIT
PAMTAGAAHLKLYDQAVVVPGPITHAVGERARLRNMVVVLGVNERDHGTLYNTQLVFDAS
GELVLKRRKITPTYHERMIWGQGDGAGLKVVDTAVGRVGALACWEHYNPLARYSLMTQHE
EIHCSQFPGSLVGPIFAEQMDVTIRHHALESGCFVINATGWLTEAQINELTTDPALQKGL
RGGCNTAIISPEGRHLVPPLTEGEGILIADLDMALITKRKRMMDSVGHYARPELLSLRLD
ATPARYVIARDDEPATGGERDAERSVYSPAADH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctggatcacgcattatccgtgccgccgcagcccagattgcgccagatctccatgag
gccagcaaaacgctggcccgggtgctggaggcaattgatcaagcggcagagcagggcgca
gagatcatcgttttccccgagacctttgtaccctattacccttatttctcgtttatcacg
cccgcgatgaccgccggtgctgcccacctgaaactttacgaccaggcggtggtggtcccc
gggccgatcacccatgccgtcggagagcgcgctcgcctgcgcaacatggtggtggtgttg
ggcgtcaatgaacgcgatcacggcacgctatacaacacccaactggtgtttgatgccagc
ggcgagctggtgctcaagcgccgcaaaattaccccgacctaccatgaacggatgatctgg
gggcagggtgatggtgccgggctgaaagtggtcgacaccgcggtagggcgtgtgggggcg
ctggcctgctgggagcattacaacccgctggcgcgctacagcctgatgacccagcacgag
gagatccattgcagccagtttcctggctcactggtggggccgatcttcgccgagcagatg
gacgtcactatccgtcaccacgcgctggagtccggctgctttgttatcaatgccaccggc
tggctgaccgaggcgcagatcaacgaacttaccacagacccggcgttgcagaaggggcta
cggggtggctgcaataccgccatcatttcgccggaaggacgccatctggtgccgccgctg
acggaaggtgaaggcattctgattgccgatctggatatggcgttaatcaccaaacgcaaa
cgcatgatggattccgtagggcattacgcgcgcccggaattattgagcctgcgtctggac
gcgacccccgcccgctatgtgatcgcacgtgatgatgaacccgcaaccggaggagagcgc
gatgcagaacgttccgtctactcgccagcagctgatcactga

DBGET integrated database retrieval system