KEGG   Pantoea sp. At-9b: Pat9b_4191Help
Entry
Pat9b_4191        CDS       T01386                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01908  propionyl-CoA synthetase [EC:6.2.1.17]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00640  Propanoate metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pat9b_4191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pao01004]
    Pat9b_4191
Enzymes [BR:pao01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.17  propionate---CoA ligase
     Pat9b_4191
Lipid biosynthesis proteins [BR:pao01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pat9b_4191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADU72755
UniProt: E6WMX0
Position
pPAT9B04:63347..65017
Genome map
AA seq 556 aa AA seqDB search
MSTISVNDTTFWQQEAQRLHWQRDFSAVVEDIDGGPRCRWFPAGRTNLSYNAVDRHLAQK
GDRCAIIQRDFRGETHRLSYRELWQQVNALSHLMISWGIRQGDRVMIALPMTPMAAVAML
ACARLGAVHVVVYSGVTSEALAQRVVACQPSLLLHSSEVRGRQALPAIPASSPTLRVADI
HSPDFSQALAQHNGCVVPCVWLEASQPSHLLFTSGTTGAPKGIVRDTGGYAVALLASFRH
LFDVQDDEIFFTTADVGWVTGHSYGIYAPLLAGITTVMCEAGTVNTPGERWWQMVEELGI
TRMLTIAGAIRLARQQGKPRASLATLRALYLAGEPLDHATHAWVSRGMGVACENHYWQTE
SGWPLLAGTDSGLAPVFTRAVDIVDPTSGEFCAPGQAGMLVVKGTLGPGGMSTLWQDDTQ
HDQRYWLRQGEQWLYATHDCAVRLNDKIIIQGRMDDVINIGGKRLATAEVEHALTGIAGI
IEVVATRTPHHLLGEMVALFVVTEGLSEQQEGVLKKQIRERLVSRCGRFALPRKIHFRRS
LPKTFSGKYLRRMLSA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgatcagcgttaatgacacgactttctggcagcaggaagcacagcgccttcac
tggcaacgggacttcagcgccgtggttgaggacattgacggcggtccgcgctgccgctgg
ttccctgcgggtcgcaccaatctgagctataacgccgtggatcgtcatttggcccagaaa
ggcgatcgctgtgcgattatccagcgtgacttccgcggagagacgcaccgactcagctac
cgtgaattgtggcagcaggtgaatgcgctcagtcacctgatgatcagctggggcattcgc
cagggggatcgggtgatgattgcgctgccgatgacgccgatggcagcggttgccatgctg
gcctgtgcccgattaggggcggtgcatgtggtggtctattcgggcgtgaccagcgaggcg
ctggcgcagcgtgtcgttgcctgccaaccctcgttgctgctgcacagtagcgaggtgcgt
ggtcgtcaggcgctaccggcgatcccggcctccagcccgaccctgcgtgtggcggatatt
cactctccggacttctctcaggccctggcacagcataatggctgcgtagtgccttgtgtc
tggctggaagcatcccagccttcacatttattgtttacctccggcaccaccggggcaccg
aaagggattgtgcgggatactggcggttacgcggtggctttgctggccagtttccgacat
ctgttcgatgttcaggatgatgaaatcttctttaccacggcggacgtgggttgggtcacg
ggtcacagctacggtatttacgcaccgttactggcggggatcaccacggtgatgtgcgag
gccggtacggtaaatacaccaggagaacgttggtggcagatggtcgaggagctggggatc
acccgcatgctgaccatcgctggtgcgattcgcctcgcgcgacagcagggaaaaccccgt
gccagtctggccacgctgcgtgctctttatcttgctggcgaaccgctggatcatgcgacc
cacgcctgggtgagccgtggaatgggtgttgcgtgtgaaaatcactactggcagaccgaa
tccggctggccgctgctggcgggaacggacagcggtttagcaccggtatttactcgcgcg
gtggatattgttgatcccaccagtggtgaattttgtgcacccggccaggcgggaatgctg
gtggtgaagggcacgcttgggccgggaggaatgtcgacgctctggcaggacgatacccaa
cacgatcaacgttactggctgcgccagggtgagcagtggctttacgccacacatgattgt
gcggtgcggctgaacgataaaatcattattcagggacggatggatgatgtgatcaacatc
ggcggtaaacgtctggcaaccgccgaggtggagcatgcactgacaggtatcgcgggcatt
attgaagtggtagcaacccgcacgccccatcatctgctgggtgaaatggtggccttgttt
gttgtcactgaggggttaagtgagcagcaagaaggggtgctgaagaagcagatacgcgag
cggttggtgagtcggtgtggccggtttgccttgccaaggaaaattcatttccggcgttca
ttaccgaagaccttttcgggaaagtatctacgccggatgttgtcagcctga

DBGET integrated database retrieval system