KEGG   Pantoea sp. At-9b: Pat9b_4193Help
Entry
Pat9b_4193        CDS       T01386                                 

Definition
(GenBank) transcriptional regulator, DeoR family
  KO
K02430  DeoR family transcriptional regulator, L-fucose operon activator
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pao03000]
    Pat9b_4193
Transcription factors [BR:pao03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    Pat9b_4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR GntR MarR_2 HTH_11 MarR HTH_24 DUF4423 E3_UFM1_ligase HTH_Crp_2 HTH_36 HTH_5 Penicillinase_R HTH_20 PaaX DUF2250 TrmB
Motif
Other DBs
NCBI-ProteinID: ADU72757
UniProt: E6WMX2
Position
pPAT9B04:66208..67047
Genome map
AA seq 279 aa AA seqDB search
MLPIERHRQIMEELNLHGRVLVAELVKLCRVSQETIRRDLSQLEKKGLLQRSHGGAVMAQ
KHQGNLAGKNNKPNEYESTFRLRMNENTQAKTLIAKRALDFITPGDCILLDSSTTCWFLA
RQLPDIELTVLTNSLRIVQTLAAKGHIRTICLGGEYSDHNEDFNGIVAEQPLKDYLINKI
FFSCSSLGNDGYLRAANENNAHLKQQMLMASERKYLLIDAGKFLRPSFARICHYREVDFL
ITDSLKDKELQQELAWNGVNIIDCSQRQNVMQLMNSQDI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgattgagcgtcaccgtcagatcatggaagaattaaatttacatggtcgggta
ttggttgcagaactggttaaactttgtcgggtttctcaggaaaccatacgcagggattta
tctcagttagagaagaaaggattattacaacgcagtcacggcggtgcggtgatggcgcag
aaacaccaggggaatttggcaggaaaaaataataaaccgaacgaatatgaatccaccttt
cgcctgcggatgaatgaaaacacccaggccaaaacattaatcgccaaaagggcgctcgat
tttattacgccgggcgattgtatattactggatagcagcaccacctgttggtttttggca
cggcagttgccagatatcgagctaacggtgctgacaaactcactgcgcatcgtgcagacg
ctggccgccaaaggccatatccgcaccatctgtctgggaggagagtattccgatcataat
gaagattttaatggcattgttgctgagcagccgctgaaagattatttaatcaacaaaata
tttttctcctgtagcagtttgggtaacgacggatatttgcgtgcagccaatgaaaataat
gcacatttaaaacaacaaatgttaatggcatcagaaaggaaatatctgctgatcgatgca
gggaaattccttcgtccttcttttgcccgaatttgccactaccgtgaagtggatttttta
ataaccgatagtctgaaagataaagaattacaacaggagctggcctggaacggcgtcaat
attatcgattgttcacaacgccagaatgtcatgcaattaatgaactctcaggatatttaa

DBGET integrated database retrieval system