KEGG   Pantoea sp. At-9b: Pat9b_4194Help
Entry
Pat9b_4194        CDS       T01386                                 

Definition
(GenBank) carbohydrate ABC transporter periplasmic-binding protein
  KO
K02058  simple sugar transport system substrate-binding protein
Organism
pao  Pantoea sp. At-9b
Module
pao_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4194
Transporters [BR:pao02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    Pat9b_4194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADU72758
UniProt: E6WMX3
Position
pPAT9B04:67052..68035
Genome map
AA seq 327 aa AA seqDB search
MKKTFIACSLLALFAATSVHAADKLRMGIVVKVGGIPWFNAMEAGIKSEAAKEGIDAWMV
GPTSADPALQVRAIEDLIAQKVDIIGVVPNDPKVLEPVLKRARDAGIRVLVHESPDQKYA
NWDFELVDAKTHGENHMKALAACMHGEGKYVAYMGGLTVPLHNAWVDSAVAYQKAHFPKM
QMVGDKFGVGESLDDSIRTTNEVMSKYPDLKGIIAFGSQGPIGAGRAVMARNKIDQVCVI
GAFSPGQGQMLVNRGAIKGGYIWNPMTAGEVFVRLAGMMQKNQPITDGMTIEGLGKVKVD
EQTHTILGNNTESLDKTNLPKLVKLGL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacatttatcgcctgttccctactggcgctgtttgctgccacctccgtccat
gctgctgacaaactgcggatggggattgtggttaaagtgggcggcattccctggttcaac
gcgatggaagccggtattaagagcgaagcggccaaagagggaattgatgcctggatggtt
ggccctacctcggccgatccggcattgcaggtcagggcgattgaagacctgattgcgcag
aaagttgacatcattggcgtggtgccaaatgacccgaaagtgctggaacccgtcctgaaa
cgcgcccgcgacgcgggtatccgcgtgctggtacatgaatcgccggatcagaagtacgcc
aactgggactttgagttggtggatgccaaaactcacggcgaaaaccatatgaaagcgctg
gccgcgtgtatgcacggcgagggcaaatatgtcgcttatatgggcggtttgacagtgccg
ctgcataacgcttgggtggattccgccgtcgcgtatcaaaaagcccatttcccgaaaatg
cagatggttggcgacaagtttggcgtcggcgaatcgctggatgattccatccgtaccacg
aatgaagtgatgtccaaatacccggatctgaaaggcattatcgccttcggttcgcagggg
ccaattggtgccggacgcgcggtgatggcgcgtaacaaaattgaccaggtctgtgtgatt
ggtgcctttagcccgggacagggtcagatgctggttaaccgtggcgcaattaaaggcggt
tacatctggaatccgatgacggcgggtgaagtcttcgtgcgccttgcgggcatgatgcag
aaaaaccaaccgattaccgacggcatgaccatcgaaggtctgggtaaggtgaaggtcgat
gagcagacccacaccattctcggcaacaacaccgaaagcctggacaaaaccaacctgcca
aaactggtcaaactggggctgtaa

DBGET integrated database retrieval system