KEGG   Pantoea sp. At-9b: Pat9b_4199Help
Entry
Pat9b_4199        CDS       T01386                                 

Definition
(GenBank) ROK family protein
  KO
K00881  allose kinase [EC:2.7.1.55]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00051  Fructose and mannose metabolism
pao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pat9b_4199
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.55  allose kinase
     Pat9b_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADU72763
UniProt: E6WMX8
Position
pPAT9B04:72280..73170
Genome map
AA seq 296 aa AA seqDB search
MSRTWLGIDIGGTSTRLLTLHGEDQWAGFRKLPTASWAQSADALGALAGLINEVLAQQPI
DGVMLGLPGILSRDRQHVVSLPFIQALDDTPVATHLSEMTGVPVAMDKDVNHLMLWDLMQ
LETLPDNAVGLYLGTGMGNSLWLNGQFYHGEHGGAGEIGHIPLANNDLPCPCGNHGCAET
LTSGHWLSQWARQHCAQTDMAQLFTLHGDHPDLQQFVSRLAKIIASEMNIIDPQYLILGG
GVLAMNDFPLASLRSQISQHLRPPVTRAGLRMVVSHATDQTGCRGACLAAARQFGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaacctggctgggtatagatattggtggtaccagcacccggttgctcaccctg
cacggggaggatcagtgggcgggatttcgcaaattgccgaccgccagctgggcacaatca
gcggatgcgttgggtgcactggctgggttgattaatgaggtgctggcacagcaaccgatt
gatggcgtcatgcttggcctgcccggcatcctgagccgcgaccgtcagcatgtggtatcg
ctgccgtttattcaggcgctggacgataccccggtggcgacccatctcagcgagatgacc
ggtgtgccggtggcgatggataaagatgttaaccatctgatgttgtgggatttaatgcag
ttggagacgctgccggataatgccgtgggcttatatctgggcactggcatgggcaacagc
ctgtggctgaacggccagttttaccacggcgagcatggtggtgcgggagagattggccac
attccgctggcgaataacgatctgccctgtccatgcggtaatcacggctgtgccgaaacg
ttaacgtcggggcactggctaagccagtgggcgcgccagcactgcgcgcaaaccgatatg
gcgcaactgtttacgttgcatggcgatcatcccgatttgcagcagtttgtcagccgcctg
gcaaaaatcatcgccagtgagatgaatattattgatccgcaatacctgatcctcggtggc
ggcgtgctggcgatgaatgattttcccctggcgtcgctgcgcagccagattagccagcat
ctgcgtccacccgtgacccgcgccggattacggatggtggtaagccatgctaccgatcag
accggttgccgtggtgcctgtctggcggccgcacggcagtttgggaggtaa

DBGET integrated database retrieval system