KEGG   Pantoea sp. At-9b: Pat9b_4209Help
Entry
Pat9b_4209        CDS       T01386                                 

Definition
(GenBank) class II aldolase/adducin family protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II UDPGT
Motif
Other DBs
NCBI-ProteinID: ADU72773
UniProt: E6WMY8
Position
pPAT9B04:82995..83633
Genome map
AA seq 212 aa AA seqDB search
MSHENTLREEICQTGFSLHQRGFTVGSSGNISARLDDGWLITPTDVCLGALQPAMIAKVN
SDGEWVKGGKPSKTLTLHRTIYQNNAEVHGIVHTHSTHLVGMTLGKVWSKAAILPPITPY
QVMKVGRIPLIDYCRPGSPLVAEQAAQLAATVKGIMLERLGPVIWGATVTKAAEILEELE
ETAKLWLMTDPKPEALDQAAMQDLFDTFDCRW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatgaaaacacccttcgtgaagaaatatgccagacaggattcagcctgcatcag
cgaggattcaccgttggcagttcaggcaatatcagtgcacgactggatgatggttggctg
atcacgccaaccgatgtctgcctcggcgcgctgcaacccgcaatgatcgctaaggtgaac
agtgacggcgagtgggtgaagggtggcaagccctcaaagacgctgaccctgcatcggacc
atttaccagaacaacgcggaggtgcatggcatcgttcatacccattcaacccatctggtc
ggcatgacgctgggcaaggtgtggagcaaagccgcgatcctgccgccgattacgccctat
caggtgatgaaagtgggcaggataccgctgatcgattattgccgtcccggttcgccattg
gtggcggaacaggcagctcagcttgcggcgacggtgaaaggcatcatgctggaacgtctc
ggcccggtgatctggggggcgacggtaaccaaagcggcggagattctggaagagctggaa
gaaaccgcgaagctgtggctgatgaccgatcctaaacccgaggcgctcgatcaggctgcg
atgcaggacttgttcgataccttcgattgccgctggtaa

DBGET integrated database retrieval system