KEGG   Pantoea sp. At-9b: Pat9b_4210Help
Entry
Pat9b_4210        CDS       T01386                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22003  aconitate Delta-isomerase [EC:5.3.3.7]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Pat9b_4210
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.7  aconitate Delta-isomerase
     Pat9b_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: ADU72774
UniProt: E6WMY9
Position
pPAT9B04:83676..84365
Genome map
AA seq 229 aa AA seqDB search
MGLQNLTIFSTLAVRAPFDNGVLAGYAASDELHFAWSPTTVIESKLAAGQHADVVIATDD
ALARLVSKGVVKAENCYPLATALFGVAVRQGAGQPDISTAQSFLDTLRAARSVCYSLGGA
SGIYLQQVMAERGILAAVEPRATKISQGFTAEKLVSGEADVAVQQMSELMVVPGIDIVGP
FPDELQQLTPFSVAVVNDCGDEVKAQLFIQYLLSEQCQRIYAANGLLCR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcagaatttgacaatattcagcacgctggccgtgcgcgcccctttcgataat
ggggtattggctggttacgcggccagcgacgaactccattttgcgtggagtcctaccacg
gtgatcgaaagcaaactggcagcaggccaacatgcggatgtggtgatcgcgaccgatgac
gcgctagcccggttggtgagtaaaggcgtggtgaaggcggaaaattgctacccgttagcc
acggccttgtttggtgttgcggtgcggcaaggtgcaggccaaccggatatttcaactgcg
cagagcttcctcgacaccctgcgtgcagcccgctcggtctgttactccctcggtggtgcc
agcgggatctatctgcagcaggtcatggccgaacgcggcattttggccgcagttgaacca
cgggccaccaaaatcagccaagggtttaccgcagaaaaattggtgagcggtgaagcagat
gtcgcggtgcagcagatgagtgaactgatggtggtgccgggaatagacatcgtgggtccg
ttcccggatgaactccagcaactgacaccgttttcggtggcagtggtgaatgattgtggc
gatgaggtcaaggcgcagttgtttattcaatatctgctgagtgaacaatgccaacgcatt
tatgcagccaatggcctgctgtgtcgctaa

DBGET integrated database retrieval system