KEGG   Pantoea sp. At-9b: Pat9b_4210Help
Entry
Pat9b_4210        CDS       T01386                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02020  molybdate transport system substrate-binding protein
Organism
pao  Pantoea sp. At-9b
Pathway
pao02010  ABC transporters
Module
pao_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pat9b_4210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4210
Transporters [BR:pao02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    Pat9b_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: ADU72774
UniProt: E6WMY9
Position
pPAT9B04:83676..84365
Genome map
AA seq 229 aa AA seqDB search
MGLQNLTIFSTLAVRAPFDNGVLAGYAASDELHFAWSPTTVIESKLAAGQHADVVIATDD
ALARLVSKGVVKAENCYPLATALFGVAVRQGAGQPDISTAQSFLDTLRAARSVCYSLGGA
SGIYLQQVMAERGILAAVEPRATKISQGFTAEKLVSGEADVAVQQMSELMVVPGIDIVGP
FPDELQQLTPFSVAVVNDCGDEVKAQLFIQYLLSEQCQRIYAANGLLCR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcagaatttgacaatattcagcacgctggccgtgcgcgcccctttcgataat
ggggtattggctggttacgcggccagcgacgaactccattttgcgtggagtcctaccacg
gtgatcgaaagcaaactggcagcaggccaacatgcggatgtggtgatcgcgaccgatgac
gcgctagcccggttggtgagtaaaggcgtggtgaaggcggaaaattgctacccgttagcc
acggccttgtttggtgttgcggtgcggcaaggtgcaggccaaccggatatttcaactgcg
cagagcttcctcgacaccctgcgtgcagcccgctcggtctgttactccctcggtggtgcc
agcgggatctatctgcagcaggtcatggccgaacgcggcattttggccgcagttgaacca
cgggccaccaaaatcagccaagggtttaccgcagaaaaattggtgagcggtgaagcagat
gtcgcggtgcagcagatgagtgaactgatggtggtgccgggaatagacatcgtgggtccg
ttcccggatgaactccagcaactgacaccgttttcggtggcagtggtgaatgattgtggc
gatgaggtcaaggcgcagttgtttattcaatatctgctgagtgaacaatgccaacgcatt
tatgcagccaatggcctgctgtgtcgctaa

DBGET integrated database retrieval system